Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

Ditetradecyl-3,3\'-thiodipropionate


9,962  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"9962"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  AMBEED, INC
Description:   Nona-1,8-dien-5-one, Purity: 95%, CAS Number: 74912-33-7, Appearance: Liquid, Storage: Sealed in dry, 2-8C, Size: 250MG
Supplier:  AMBEED, INC
Description:   7-Bromoquinolin-4(1H)-one, Purity: 97%, CAS Number: 956268-33-0, Appearance: Solid, Storage: Inert atmosphere, Room Temperature, Size: 1G
Supplier:  AMBEED, INC
Description:   2-(Isopropylthio)aniline 95%
Supplier:  Thermo Scientific Chemicals
Description:   100G
MSDS SDS
Supplier:  AMBEED, INC
Description:   3,5-Difluoropyridine 97%
Supplier:  AMBEED, INC
Description:   N-Methyl-N,N-dioctyloctan-1-aminium bis((trifluoromethyl)sulfonyl)amide, Purity: 98%, CAS Number: 375395-33-8, Appearance: Colorless to Yellow Viscous Liquid, Storage: Inert atmosphere, Room Temperature, Size: 100g
Supplier:  BeanTown Chemical
Description:   CAS: 121-33-5; EC No: 204-465-2; MDL No: MFCD00006942; RTECS: YW5775000 Solid; Linear Formula: (HO)C6H3(OCH3)CHO; Molecular Formula: C8H8O3; MW: 152.15 Melting Point: 81-83°; Boiling Point: 170°/15 mmHg; Flash point: 153°C (307°F) Density (g/mL): 1.056 Air Sensitive, Light Sensitive, Moisture Sensitive
MSDS SDS
Supplier:  AMBEED, INC
Description:   1-(4-Chlorophenyl)-3-(1-methyl-1H-pyrazol-4-yl)propane-1,3-dione, Purity: 97%, CAS Number: 1503529-33-6, Appearance: Solid, Storage: Keep in dark place, Sealed in dry, 2-8C, Size: 250MG
Catalog Number: (80085-308)

Supplier:  WTW
Description:   For Ph/Orp Electrodes With Plug Head, 3.3 Ft (1 M) Cable.
Supplier:  ACROBIOSYSTEMS INC MS
Description:   Cynomolgus IL-33 Protein, His Tag, ACROBiosystems
Catalog Number: (103003-038)

Supplier:  Anaspec Inc
Description:   Purified metalloendopeptidase cleaves the Gly33-Leu34 bond of Alzheimer Aß (1-40) peptide producing soluble 1-33 and 34-40 fragments of Aß (1-40) without any neurotoxic effects.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIG
Molecular Weight: 3674 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Catalog Number: (100205-764)

Supplier:  Strem Chemicals Inc
Description:   CAS #: 7440-33-7. Size: 100m.
Supplier:  ACROBIOSYSTEMS INC MS
Description:   Mouse IL-33 Protein, His Tag (MALS verified), ACROBiosystems
Supplier:  AMBEED, INC
Description:   2-Amino-4,6-dichloropyrimidine-5-carbonitrile, Purity: 95%, CAS Number: 1277179-33-5, Appearance: White to yellow powder or crystals, Storage: Keep in dark place, Inert atmosphere, Store in freezer, under -20 C, Size: 5g
Supplier:  AMBEED, INC
Description:   4-Amino-7-(B-D-ribofuranosyl)pyrrolo[2,3-d]pyrimidine, Purity: 98%, CAS Number: 69-33-0, Appearance: White to off-white powder or crystals, Storage: Keep in dark place, Inert atmosphere, Room temperature, Size: 250MG

Supplier:  Abnova
Description:   Rabbit polyclonal antibody raised against Clostridium botulinum Type A Hemagglutinin 33.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
2,161 - 2,176  of 9,962