Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

2',4'-Difluoro-4-hydroxybiphenyl


146,026  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"146026"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 


Supplier:  LGC STANDARDS
Description:   6-Amino-5-bromoquinoxaline, TRC, LGC Standards
New Product
Supplier:  Bachem Americas
Description:   Sequence: Fmoc-7-aminoheptanoic acid
Supplier:  Thermo Scientific Chemicals
Description:   Nalpha-Benzyloxycarbonyl-L-ornithine, 98%
MSDS SDS
Supplier:  MilliporeSigma
Description:   Cas Number:25102-12-9 25G
MSDS SDS
Supplier:  Thermo Scientific Chemicals
Description:   5g CAS: 201484-50-6, MDL: MFCD00672337
MSDS SDS
Catalog Number: (101812-474)

Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 021643-500MG , MDL Number: MFCD08688016
Catalog Number: (200000-982)

Supplier:  Acros Organics
Description:   Size: 25GM. CAS Number: 73-22-3.
MSDS SDS
Supplier:  MilliporeSigma
Description:   A non-specific protease liquefies mucins and digests proteins to free amino acids.

Supplier:  Bioss
Description:   The protein encoded by ANP32C is one of at least two proteins that are similar in amino acid sequence to PP32 and are part of the same acidic nuclear phosphoprotein gene family. However, unlike PP32, the encoded protein is tumorigenic. The tumor suppressor function of PP32 has been localized to a 25 amino acid region that is divergent between PP32 and the protein encoded by this gene. This gene does not contain introns.
Supplier:  Enzo Life Sciences
Description:   Dihydrofolate reductase inhibitor

Supplier:  Bioss
Description:   The glycoprotein encoded by this gene is a cell surface antigen that is expressed in greater than 95% of human colon cancers. The open reading frame encodes a 319 amino acid polypeptide having a putative secretory signal sequence and 3 potential glycosylation sites. The predicted mature protein has a 213 amino acid extracellular region, a single transmembrane domain, and a 62 amino acid intracellular tail. The sequence of the extracellular region contains 2 domains characteristic of the CD2 subgroup of the immunoglobulin (Ig) superfamily.
Supplier:  Enzo Life Sciences
Description:   Irreversible, cell permeable broad-spectrum caspase inhibitor.
Supplier:  AMBEED, INC
Description:   (S)-tert-Butyl 2-amino-3-methylbutanoate hydrochloride, Purity: 95%, CAS number: 13518-40-6, Appearance: Form: Crystal - Powder / Colour: White - Almost white, Storage: Inert atmosphere, Room Temperature, Size: 1G
Supplier:  Spectrum Chemicals
Description:   Amido Black 10B, also known as Amidoschwarz, is used to stain for total protein on transferred membrane blots in biochemical research.
Small Business Enterprise
Supplier:  Anaspec Inc
Description:   This is amino acids 1 to 42 fragment of mouse and rat beta-amyloid. It differs from human beta-amyloid by three amino acid residues: Arg5, Tyr10, and His13. Residues in human beta-amyloid correspond to Gly5, Phe10, and Arg13 in mice and rat sequence.
Sequence: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 4418 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Supplier:  Bachem Americas
Description:   Sequence: Z-Glu-OMe
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
6,145 - 6,160  of 146,026