Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

Ethyl+2-fluoro-4,5-dimethylbenzoate


50,868  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"50868"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  AMBEED, INC
Description:   2-Fluoro-5-hydroxypyridine 98%
Supplier:  AMBEED, INC
Description:   4-Fluoro-3-iodobenzoic acid 95%
Supplier:  AMBEED, INC
Description:   2-Fluoro-3-iodobenzoic acid 95%
Supplier:  AMBEED, INC
Description:   9,10-Dimethoxy-5,6-dihydro-[1,3]dioxolo[4,5-g]isoquinolino[3,2-a]isoquinolin-7-ium hydrogensulfate 99+%
New Product
Supplier:  AOB CHEM USA
Description:   3-Fluoro-5-formylbenzoic acid ≥97%
Supplier:  Matrix Scientific
Description:   Tetramethyl-9'-ethoxy-5',5'-dimethyl-5',6'-dihydrospiro[1,3-dithiole-2,1'-thiopyrano[2,3-c]quinoline]-2',3',4,5-tetracarboxylate
Supplier:  AOB CHEM USA
Description:   2-Fluoro-3-hydroxy-4-methoxybenzaldehyde ≥97%
Supplier:  AOB CHEM USA
Description:   5'-Fluoro-2'-methylacetophenone ≥97%
Supplier:  AMBEED, INC
Description:   2-Fluoro-6-nitrobenzaldehyde, Purity: 97%, CAS Number: 1644-82-2, Appearance: Solid, Storage: Inert atmosphere, 2-8 C, Size: 25g
Catalog Number: (77415-044)

Supplier:  APOLLO SCIENTIFIC
Description:   2-Fluoro-4-nitrotoluene 98%

Supplier:  Ricca Chemical
Description:   Acetate Buffer, pH 4.5, Ricca Chemical Company
MSDS SDS
Small Business Enterprise
Catalog Number: (103006-368)

Supplier:  Anaspec Inc
Description:   BNP-45 represents the 45 amino acids at the C-terminus and the mouse BNP-45 has all the amino acid residues thought essential for NP bioactivity, although sequence identity when studied with other BNP hormones (rat, 64%; dog, 53%; pig, 50%; and human, 44%) was clearly less than the identity among ANF hormones. The threonine 81 residue at which a protein kinase C phosphorylation site is present in the putative mature mouse BNP-45 hormone is not conserved in the rat sequence.
Sequence:SQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Disulfide bridge:23 - 39)
MW:5040.8 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Catalog Number: (77783-119)

Supplier:  AMBEED, INC
Description:   1-Fluoro-9H-carbazole, 95%
New Product
Supplier:  APOLLO SCIENTIFIC
Description:   5-Fluoro-2-methylbenzyl bromide 97%
Supplier:  AMBEED, INC
Description:   (Z)-Methyl 2-(1-(2-chlorophenyl)-4-((3-(dimethylamino)phenyl)(methylamino)methylene)-5-oxo-4,5-dihydro-1H-pyrazol-3-yl)acetate, Purity: 95%, CAS Number: 1820587-57-2, Appearance: White to off-white powder or crystals, Storage: Keep in dark place, Sealed in dry, 2-8 C, Size: 250mg
Supplier:  AMBEED, INC
Description:   (4S,4'S)-2,2'-(Propane-2,2-diyl)bis(4-methyl-4,5-dihydrooxazole), Purity: 97%, CAS Number: 181708-51-0, Appearance: Solid or Semi-solid or liquid, Storage: Inert atmosphere, 2-8C, Size: 100MG
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
4,289 - 4,304  of 50,868