Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

Ethyl+2-fluoro-4,5-dimethylbenzoate


50,771  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"50771"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  AOB CHEM USA
Description:   1-(Benzyloxy)-3-fluoro-2-iodo-4-methylbenzene 97
Supplier:  AOB CHEM USA
Description:   1-Bromo-2-chloro-4-fluoro-5-methoxybenzene 97
Catalog Number: (103006-368)

Supplier:  Anaspec Inc
Description:   BNP-45 represents the 45 amino acids at the C-terminus and the mouse BNP-45 has all the amino acid residues thought essential for NP bioactivity, although sequence identity when studied with other BNP hormones (rat, 64%; dog, 53%; pig, 50%; and human, 44%) was clearly less than the identity among ANF hormones. The threonine 81 residue at which a protein kinase C phosphorylation site is present in the putative mature mouse BNP-45 hormone is not conserved in the rat sequence.
Sequence:SQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Disulfide bridge:23 - 39)
MW:5040.8 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Supplier:  Thermo Scientific Chemicals
Description:   6-Fluoro-2-picoline. Grade: 98, Melting Point C. Boiling Point C: 140-141*. C6H6FN. 407-22-7. IRRITANT
MSDS SDS
Catalog Number: (77414-952)

Supplier:  APOLLO SCIENTIFIC
Description:   2-Fluoro-3-methylpyridine 98%
Supplier:  Matrix Scientific
Description:   MF=C13H24N2O2 MW=240.35 Cas=960294-16-0 250Mg
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 039399-500MG , MDL Number: MFCD12027884
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 039362-500MG , MDL Number: MFCD12027847
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 033358-500MG , MDL Number: MFCD03030173
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 060356-500MG , MDL Number: MFCD13250113
Supplier:  TCI America
Description:   2-Chloro-5-fluoro-3-methylpyridine, CAS Number: 38186-84-4, Purity: 98.0%, Molecular Formula: C6H5ClFN, Molecular Weight: 145.56 g/mol, Synonyms: 2-Chloro-5-fluoro-3-picoline, Physical Form: Solid, Size: 1G
MSDS SDS
Supplier:  AOB CHEM USA
Description:   2-Fluoro-3,4-dimethoxybenzoic acid 97
Supplier:  AOB CHEM USA
Description:   6-Chloro-2-fluoro-3-methoxy-N-methylbenzamide 97
Supplier:  APOLLO SCIENTIFIC
Description:   4-Chloro-2-fluoro-5-iodophenol

Supplier:  Ricca Chemical
Description:   Acetate Buffer, pH 4.5, Ricca Chemical Company
MSDS SDS
Small Business Enterprise
Supplier:  AOB CHEM USA
Description:   2-Fluoro-3-hydroxy-5-methylpyridine ≥97%
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
4,401 - 4,416  of 50,771