Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

Ethyl+3,6-dibromo-2-fluorobenzoate


30,669  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"30669"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  Matrix Scientific
Description:   MF=C6H4Br2 MW=235.92 Cas=108-36-1 MDL=MFCD00000078 100G
Supplier:  Anaspec Inc
Description:   GLP-1 (7-36) amide is an incretin hormone that causes glucose dependent release of insulin by pancreatic beta cells. It is the cleavage product of GLP-1 (1-36) amide peptide. Both GLP-1 (7-36) and GLP-1 (7-37), also play roles in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. GLP-1 (7-36) has a short half life of less than 2 minutes, and like GIP, is rapidly degraded by the enzyme dipeptidyl peptidase IV (DPP-4), which is widely expressed in a number of sites, including the endothelial cells of small gut arterioles. DPP-4 degrades GLP-1 (7-36) into the non insulinotropic GLP-1 (9-36) (some studies suggest it may have weak insulinotropic activity). As a result, the majority of GLP-1 (and GIP) is inactivated as an insulinotrope before reaching the systemic circulation.
Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
MW: 3297.7 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Supplier:  TCI America
Description:   CAS Number: 1120-36-1
MDL Number: MFCD00008981
Molecular Formula: C14H28
Molecular Weight: 196.38
Purity/Analysis Method: >90.0% (GC)
Form: Clear Liquid
Color: Colorless
Boiling point (°C): 232
Flash Point (°C): 112
Specific Gravity (20/20): 0.77
MSDS SDS
Supplier:  AMBEED, INC
Description:   4-Chloro-7-methoxyquinoline-6-carboxamide, Purity: 97%, CAS Number: 417721-36-9, Appearance: Solid, Storage: Inert atmosphere, Room Temperature, Size: 250mg
Supplier:  AMBEED, INC
Description:   2-Methoxy-1,3,4-trimethylbenzene, Purity: 98%, CAS Number: 21573-36-4, Appearance: Liquid, Storage: Sealed in dry, Room Temperature, Size: 25G
Supplier:  Thermo Scientific Chemicals
Description:   Grade: 97, Melting Point C. Boiling Point C: 67-68*/50mm. C6H8O. 1679-36-3. FLAMMABLE
MSDS SDS
Supplier:  Matrix Scientific
Description:   4-(Methylthio)-2-phenyl-1H-pyrazolo[4,3-c]pyridine-3,6(2H,5H)-dione
Supplier:  AMBEED, INC
Description:   3,5-Dichloro-4-hydroxybenzaldehyde, Purity: 98%, CAS Number: 2314-36-5, Appearance: White to Yellow to Yellow-brown Solid, Storage: Inert atmosphere, 2-8 deg C, Size: 10g
Catalog Number: (102539-458)

Supplier:  Matrix Scientific
Description:   MF=C4H6N2 MW=82.11 CAS=822-36-6 MDL=MFCD00005201 100G
Supplier:  TCI America
Description:   CAS Number: 71172-36-6
MDL Number: MFCD00039506
Molecular Formula: C11H18N2
Molecular Weight: 178.28
Purity/Analysis Method: >95.0% (GC)
Form: Clear Liquid
Color: Colorless
Boiling point (°C): 190
Specific Gravity (20/20): 0.91
MSDS SDS
Supplier:  BeanTown Chemical
Description:   CAS: 930-36-9; EC No: 000-000-0; MDL No: MFCD00144943 UN No: UN1993; Haz Class: 3; Packing Group: III Liquid; Molecular Formula: C4H6N2; MW: 82.10 Flash point: 36°C (97°F) Density (g/mL): 0.988; Refractive Index: 1.477
MSDS SDS
Supplier:  AMBEED, INC
Description:   Pyrimidine-2-thiol, Purity: 98%, CAS Number: 131242-36-9, Appearance: Solid, Storage: Keep in dark place, Inert atmosphere, 2-8C, Size: 500G
Supplier:  Matrix Scientific
Description:   MF=C9H8F3No MW=203.17 Cas=351-36-0 MDL=MFCD00000383 25G
Supplier:  TCI America
Description:   CAS Number: 54446-36-5
MDL Number: MFCD07779504
Molecular Formula: C12H10BrN
Molecular Weight: 248.12
Purity/Analysis Method: >98.0% (GC)
Form: Crystal
Boiling point (°C): 318
Melting point (°C): 87
MSDS SDS

Supplier:  VWR International
Description:   This fast-acting, alcoholic counterstain stains erythrocytes, collagen, and the cytoplasm of muscle (epithelial cells) different shades of pink
MSDS SDS
Catalog Number: (TCD4800-200MG)

Supplier:  TCI America
Description:   Dicamba, Purity: >98.0%(GC)(T), CAS Number: 1918-00-9, Molecular Formula: C8H6Cl2O, Molecular Weight: 221.03, Synonym: 3,6-Dichloro-2-methoxybenzoic Acid, 3,6-Dichloro-o-anisic Acid, MDBA, Form: Crystal-Powder, Solid, Color: White - Almost white, Size: 200MG
MSDS SDS
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
3,729 - 3,744  of 30,669