Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

Ethyl+3,6-dibromo-2-fluorobenzoate


31,214  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"31214"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Catalog Number: (102513-478)

Supplier:  Adipogen
Small Business Enterprise
Supplier:  AMBEED, INC
Description:   (S)-(-)-N-(1-Phenylethyl)phthalamic acid 98%
Supplier:  TCI America
Description:   CAS Number: 3387-36-8
MDL Number: MFCD00006525
Molecular Formula: C9H13N2O9P
Molecular Weight: 368.15
Purity/Analysis Method: >98.0% (HPLC)
Form: Crystal
Color: White
Specific rotation [a]20/D: -14 deg (C=1, H2O)
Storage Temperature: 0-10°C
MSDS SDS

Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 025271-500MG , MDL Number: MFCD09997194
Supplier:  Janitorial Supplies
Description:   This sturdy dust mop head is made from a 4-ply cotton/synthetic blend. It has looped ends as well as reinforced backing ends and reinforced stress points for extra durability.
Supplier:  THERMO FISHER SCIENTIFIC CHEMICALS
Description:   Sodium tetrachloropalladate(II) (∼36% Pd)

Supplier:  Anaspec Inc
Description:   A 36-amino acid Cl- channel blocker from Leiurus quinquestriatus scorpion venom.
Sequence:MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR-NH2 (Disulfide bridge: 2-19,5-28,16-33,20-35)
MW:3996 Da
% peak area by HPLC:95
Storage condition:-20° C
Catalog Number: (10109-636)

Supplier:  Prosci
Description:   The elongation of primed DNA templates by DNA polymerase delta and DNA polymerase epsilon requires the accessory proteins proliferating cell nuclear antigen (PCNA) and replication factor C (RFC). RFC, also named activator 1, is a protein complex consisting of five distinct subunits of 140, 40, 38, 37, and 36 kD. RFC5 is the 36 kD subunit. This subunit can interact with the C-terminal region of PCNA. It forms a core complex with the 38 and 40 kDa subunits. The core complex possesses DNA-dependent ATPase activity, which was found to be stimulated by PCNA in an in vitro system.The elongation of primed DNA templates by DNA polymerase delta and DNA polymerase epsilon requires the accessory proteins proliferating cell nuclear antigen (PCNA) and replication factor C (RFC). RFC, also named activator 1, is a protein complex consisting of five distinct subunits of 140, 40, 38, 37, and 36 kD. This gene encodes the 36 kD subunit. This subunit can interact with the C-terminal region of PCNA. It forms a core complex with the 38 and 40 kDa subunits. The core complex possesses DNA-dependent ATPase activity, which was found to be stimulated by PCNA in an in vitro system. Alternatively spliced transcript variants encoding distinct isoforms have been reported.
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 053502-500MG , MDL Number: MFCD13562827

Supplier:  APOLLO SCIENTIFIC
Description:   2-Fluoro-5-methyl-4-(trifluoromethyl)benzylamine 97%
Supplier:  Biolegend
Description:   Purified Mouse IgE, κ Isotype Ctrl [MEA-36]; Isotype: Mouse (BALB/c) IgE, κ; Reactivity: Trinitrophenol (TNP); Apps: ELISA, FC, WB; Size: 100 μg
Catalog Number: (TCF0143-025G)

Supplier:  TCI America
Description:   CAS Number: 3520-42-1
MDL Number: MFCD00010180
Molecular Formula: C27H30N2O7S2
Molecular Weight: 580.65
Form: Powder
Color: Purple
MSDS SDS
Supplier:  Bachem Americas
Description:   Sequence: H-D-Asp-OtBu
Supplier:  AMBEED, INC
Description:   2-(4-Fluoro-3-(trifluoromethyl)benzyl)-4,4,5,5-tetramethyl-1,3,2-dioxaborolane ≥97%
New Product

Supplier:  VWR International
Description:   Anhydrous reagent grade alcohol is a denatured form of ethyl alcohol, approved for sale under U.S. regulations (90 parts ethyl alcohol, 5 parts methyl alcohol, and 5 parts isopropyl alcohol).
MSDS SDS
Minority or Woman-Owned Business Enterprise Product available on GSA Advantage®
Supplier:  AMBEED, INC
Description:   4-(6-(2-(3-Methylbenzylidene)hydrazinyl)-2-(2-(pyridin-2-yl)ethoxy)pyrimidin-4-yl)morpholine dimethanesulfonate, Purity: 98%, CAS Number: 870087-36-8, Appearance: White to Pale-yellow to Yellow-brown Solid, Storage: Inert atmosphere, Room Temperature, Size: 1mg
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
5,649 - 5,664  of 31,214