Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results


SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"31242"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  Thermo Scientific Chemicals
Description:   4-(Ethoxycarbonylamino)piperidine, 97%
MSDS SDS
Supplier:  Heathrow Scientific
Description:   These durable tube racks are molded in a single, continuous piece so no assembly is required and there are no detachable pieces.
Supplier:  TCI America
Description:   CAS Number: 18531-94-7
MDL Number: MFCD00004068
Molecular Formula: C20H14O2
Molecular Weight: 286.33
Purity/Analysis Method: >98.0% (HPLC,T)
Form: Crystal
Melting point (°C): 210
Specific rotation [a]20/D: 36 deg (C=1, THF)
MSDS SDS
Supplier:  Anaspec Inc
Description:   GLP-1 (7-37) is an incretin hormone that causes glucose dependent release of insulin by pancreatic beta cells. It is the cleavage product of proglucagon. Both GLP-1 (7-36) and GLP-1 (7-37) play roles in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. Although GLP-1 (7-37) is bioactive, it is available in lesser amounts than GLP-1 (7-36) and is not amidated.
Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
MW: 3355.7 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Supplier:  TCI America
Description:   CAS Number: 13035-19-3
MDL Number: MFCD02179399
Molecular Formula: C5H12N2
Molecular Weight: 100.17
Purity/Analysis Method: >96.0% (GC,T)
Form: Crystal
Boiling point (°C): 36
Flash Point (°C): 48
Freezing point (°C): 25
MSDS SDS
Catalog Number: (470148-780)

Supplier:  Shiv Dial Sud & Sons
Description:   CAS Number: 7440-50-8
Formula: Cu
Density: 8.92 g/mL
Boiling Point: 2595°C
Freezing Point: 1083°C
Synonyms: Copper Metal
Shelf Life: 36 Months

Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 029953-500MG , MDL Number: MFCD04140918

Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 062717-500MG , MDL Number: MFCD12827526
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 038911-500MG , MDL Number: MFCD09669476
Supplier:  Thermo Scientific Chemicals
Description:   MDL: MFCD00001593 Beilstein Registry No.: 747939 Fieser: 1,215 14,126 15,125 16,120 18,130 19,121 20,137 21,164
MSDS SDS
Supplier:  Enzo Life Sciences
Description:   Mitochondria dye
Catalog Number: (103194-038)

Supplier:  Aqua Solutions
Description:   Hydrochloric Acid in Methanol, 0.01 normal, N.I.S.T. Traceable, Components: Methanol, Hydrochloric Acid 36-38%, Form: Liquid, Colour: Clear, Pack Size: 4L
MSDS SDS
Supplier:  Cryopak Verification Technologies
Description:   Pre-qualified shipping solutions are tested to the highest quality standards to preserve the integrity of transported products.

Supplier:  Honeywell Safety Products
Description:   Durable waterproof kits are constructed of plastic or metal and equipped with carrying handles and brackets for versatile mounting throughout a facility.
Supplier:  Dickies
Description:   Dickies® style 83294.
Supplier:  THERMO FISHER SCIENTIFIC CHEMICALS
Description:   Titanium(IV) ethanolate (33 - 35% TiO₂)
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
929 - 944  of 31,242