Text Search >
2-(4-Bromophenyl)-2-methylpropanoic+acid
Print…
You Searched For:
74,359 results were found
2-(4-Bromophenyl)-2-methylpropanoic+acid
Supplier:
Enzo Life Sciences
Description:
Produced in <i>E. coli.</i> Non-glycosylated protein, containing 145 amino acids.
Catalog Number:
(RL206031430100)
Supplier:
Rockland Immunochemical
Description:
D-Amino Acid Oxidase [Pig Kidney] in a standard capture ELISA using ABTS as a substrate for 30 minutes at room temperature
Supplier:
Spectrum Chemicals
Description:
Amido Black 10B, also known as Amidoschwarz, is used to stain for total protein on transferred membrane blots in biochemical research.
Catalog Number:
(10072-082)
Supplier:
Prosci
Description:
Oncostatin M (OSM) is a growth and differentiation factor that participates in the regulation of neurogenesis, osteogenesis and hematopoiesis. Produced by activate T cells, monocytes and Kaposi’s sarcoma cells, OSH can exert both stimulatory and inhibitory effects on cell proliferation. It stimulates the proliferation of fibroblasts, smooth muscle cells and Kaposi’s sarcoma cells, but, inhibits the growth of some normal and tumor cell lines. It also promotes cytokine release (e.g. IL-6, GM-CSF and G-CSF) from endothelial cells, and enhances the expression of low-density lipoprotein receptor in hepatoma cells. OSM share several structural and functional characteristics with LIF, IL-6, and CNTF. Human OSM is active on murine cells. The human OSM gene encodes for a 252 amino acid polypeptide, containing 25 amino acid signal sequence for secretion and a 227 precursor protein. Proteolytic processing of this precursor removes an 18 amino acid C-terminal peptide and generates the mature OSM form. Recombinant human Oncostatin M is a 23.9 kDa protein, containing 209 amino acid residues.
Supplier:
Anaspec Inc
Description:
This is amino acids 1 to 42 fragment of mouse and rat beta-amyloid. It differs from human beta-amyloid by three amino acid residues: Arg5, Tyr10, and His13. Residues in human beta-amyloid correspond to Gly5, Phe10, and Arg13 in mice and rat sequence.
Sequence: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA Molecular Weight: 4418 Da % Peak Area by HPLC: ≥95 Peptide Content: ≥ 60% Storage condition: -20°C
Catalog Number:
(75789-612)
Supplier:
Prosci
Description:
Complement Factor H-Related Protein 2 (CFHR2) is a secreted protein that belongs to the complement factor H protein family. Members of the H-related protein family are exclusively composed of individually folded protein domains, termed short consensus repeats (SCRs) or complement control modules. CFHR2 is synthesized as a 270 amino acid precursor that contains an 18 amino acid signal peptide and a 252 amino acid mature chain with 4 Sushi (CCP/SCR) domains. CFHR2 is synthesized in the liver and secreted into plasma. It may be involved in complement regulation. CFHR2 can also be associated with lipoproteins and may play a role in lipid metabolism.
Supplier:
AMBEED, INC
Description:
(S)-tert-Butyl 2-amino-3-methylbutanoate hydrochloride, Purity: 95%, CAS number: 13518-40-6, Appearance: Form: Crystal - Powder / Colour: White - Almost white, Storage: Inert atmosphere, Room Temperature, Size: 1G
Catalog Number:
(102599-126)
Supplier:
Chem Impex International
Description:
Crosslinking agent for compounds carrying an amino group
Catalog Number:
(10072-610)
Supplier:
Prosci
Description:
BMPs (Bone Morphogenetic Proteins) belong to the TGF-beta superfamily of structurally related signaling proteins. BMP-2 is a potent osteoinductive cytokine, capable of inducing bone and cartilage formation in association with osteoconductive carriers such as collagen and synthetic hydroxyapatite. In addition to its osteogenic activity, BMP-2 plays an important role in cardiac morphogenesis and is expressed in a variety of tissues including lung, spleen, brain, liver, prostate ovary and small intestine. The functional form of BMP-2 is a 26 kDa protein composed of two identical 114 amino acid polypeptide chains linked by a single disulfide bond. Each BMP-2 monomer is expressed as the C-terminal part of a precursor polypeptide, which also contains a 23 amino acid signal sequence for secretion, and a 259 amino acid propeptide. After dimerization of this precursor, the covalent bonds between the propeptide (which is also a disulfide-linked homodimer) and the mature BMP-2 ligand are cleaved by a furin-type protease. Recombinant human BMP-2 is a 26.0 kDa homodimeric protein consisting of two 115 amino acid polypeptide chains.
Catalog Number:
(103003-184)
Supplier:
Anaspec Inc
Description:
This peptide is derived from fibrinopeptide B amino acid residues 1-14. It is used as a mass spec (MS) standard in proteomic research.
Sequence:EGVNDNEEGFFSAR MW:1570.6 Da % peak area by HPLC:95 Storage condition:-20° C
Catalog Number:
(10782-444)
Supplier:
Biosensis
Description:
The Human influenza hemagglutin (HA) tag corresponds to a region (98-106 amino acids) from the HA molecule.
Supplier:
Enzo Life Sciences
Description:
Produced in <i>E. coli.</i> Non-glycosylated protein, containing 147 amino acids.
Supplier:
Thermo Scientific Chemicals
Description:
Reagent that protects tryptophan in amino acid analysis
Catalog Number:
(100277-262)
Supplier:
Indofine Chemical Company
Description:
Rare Organics & BioChemicals 1gm BOC-D-Bta-OH 321.4 Room temperature.
Catalog Number:
(89352-570)
Supplier:
Genetex
Description:
The V5 epitope tag is derived from a small epitope (Pk) present on the P and V proteins of the paramyxovirus of simian virus 5 (SV5). The V5 tag is usually used with all 14 amino acids (GKPIPNPLLGLDST), although it has also been used with a shorter 9 amino acid sequence (IPNPLLGLD).
Catalog Number:
(TCS0462-1G)
Supplier:
TCI America
Description:
CAS Number: 1464-42-2
MDL Number: MFCD00063089 Molecular Formula: C5H11NO2Se Molecular Weight: 196.11 Purity/Analysis Method: >98.0% (HPLC,T) Form: Crystal Color: White Storage Temperature: 0-10°C
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
 is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||
List View
