Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

2-Ethoxy-5-ethylphenol


22,242  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"22242"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  LGC STANDARDS
Description:   11-H-Eicosafluoroundecanoic acid, Dr. Ehrenstorfer, LGC Standards
New Product
Supplier:  Matrix Scientific
Description:   MF=C9H7NS MW=161.23 CAS=1826-11-5 MDL=MFCD00272327 1G
Supplier:  AMBEED, INC
Description:   (S)-2-((Methoxycarbonyl)amino)-3,3-dimethylbutanoic acid, Purity: 97%, CAS Number: 162537-11-3, Appearance: Form: powder, Storage: Keep in dark place, Sealed in dry, Room Temperature, Size: 100g
Supplier:  AMBEED, INC
Description:   5,6,7,8-Tetrahydroimidazo[1,2-a]pyridine-2-carboxylic acid, Purity: 98%, CAS Number: 917364-11-5, Appearance: White to yellow powder or crystals, Storage: Sealed in dry, Room Temperature, Size: 250MG
Catalog Number: (103007-598)

Supplier:  Anaspec Inc
Description:   This is amino acids 11 to 42 fragment of beta-amyloid. This peptide was detected in Alzheimer disease brains within several principal beta-amyloid variants.
Sequence: EVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 3335.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier:  AMBEED, INC
Description:   (4-((Benzyloxy)carbonyl)phenyl)boronic acid, Purity: 97%, CAS Number: 184000-11-1, Appearance: White to Very pale yellow Solid, Storage: Inert atmosphere, 2-8C, Size: 250MG

Supplier:  VWR International
Description:   Meets ACS specifications for general use.
MSDS SDS
Supplier:  AMBEED, INC
Description:   (SP-5-13)-Chloro[[2,2'-[1,2-ethanediylbis[(nitrilo-KN)methylidyne]]bis[4,6-bis(1,1-dimethylethyl)phenolato-KO]](2-)]manganese, Purity: 97%, CAS Number: 172172-24-6, Appearance: Solid, Storage: Inert atmosphere, Room Temperature, Size: 10G
Catalog Number: (ABCA_AB212605-100U)

Supplier:  ABCAM INC.
Description:   Anti-CD99 Mouse Monoclonal Antibody [clone: HO36-1.1]
New Product

Supplier:  THERMO FISHER SCIENTIFIC CHEMICALS
Description:   Nickel 99.97% (trace metals basis), spheres 5 --> 11 mm
New Product

Supplier:  Genetex
Description:   Hamster monoclonal antibody [HM79-11] to CD79b
Catalog Number: (10072-434)

Supplier:  Prosci
Description:   IL-11 is a multifunctional cytokine produced by stromal cells such as fibroblasts, epithelial cells and osteoclasts. It is expressed in a wide variety of tissues including thymus, lung, bone, connective tissue and central nervous system. IL-11 plays an important regulatory role in hematopoiesis by stimulating growth of myeloid, erythroid and megakaryocyte progenitor cells. It also regulates bone metabolism, inhibits production of proinflammatory cytokines and protects against gastromucosal injury. Recombinant Murine IL-11 is a 19.1 kDa protein consisting of 179 amino acid residues.
Supplier:  TCI America
Description:   CAS Number: 93-11-8
MDL Number: MFCD00004087
Molecular Formula: C10H7ClO2S
Molecular Weight: 226.67
Purity/Analysis Method: >98.0% (GC,T)
Form: Crystal
Melting point (°C): 77
MSDS SDS
Supplier:  Strem Chemicals Inc
Description:   MANDYPHOS, Phosphine

Supplier:  ANTIBODIES.COM LLC
Description:   Human Smooth Muscle Myosin Heavy Chain 11 ELISA kit is a 90 minutes sandwich Enzyme-Linked Immunosorbent Assay (sELISA) designed for the <i>in vitro</i> quantitative determination of human Smooth Muscle Myosin Heavy Chain 11 in serum, plasma, and other biological fluids.
Supplier:  Thermo Scientific Chemicals
Description:   98%. 50g.
MSDS SDS
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
7,185 - 7,200  of 22,242