Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

Stills


940  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"940"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Catalog Number: (AAJ64180-A1)

Supplier:  Thermo Scientific Chemicals
Description:   Crystalline
MSDS SDS

Supplier:  DWK Life Sciences (KIMBLE)
Description:   These autosampler vials with open top caps are ideal for the analysis of volatile organic compounds.
Small Business Enterprise
Supplier:  Bullard
Description:   Powered Air-Purifying Respirator with AM-FM-MA-AG-HE Filter Cartridges for ammonia, formaldehyde, methylamine, chlorine, hydrogen chloride, sulfur dioxide, chlorine dioxide, hydrogen fluoride and particulates
Supplier:  Qorpak
Description:   The vacuum and ionized cleaning process removes contaminants such as loose dirt, carton lint, aerosols, and fine glass particles.
Small Business Enterprise
Catalog Number: (76245-578)

Supplier:  MOUSER ELECTRONICS TE
Description:   Lithium Batteries, Mouser Electronics
Supplier:  AAT BIOQUEST INC
Description:   6-ROX is predominately used as a reference dye for performing PCR detections.
Small Business Enterprise Minority or Woman-Owned Business Enterprise

Supplier:  Honeywell Safety Products
Description:   For use with North Safety Products air purifying dual cartridge respirators (see 56222-944 series).
Supplier:  Bachem Americas
Description:   For desmopressin see H-7675.
Supplier:  MicroSolv Technology Corp
Description:   Due to the propriety coating process these vials and inserts have extreme hydrolytic stability making them stable in water and other solvents for a very long period of time.
Supplier:  AAT BIOQUEST INC
Description:   Differentiates live yeast with intact membranes will stain fluorescent green, and dead yeast with damaged membranes will stain fluorescent red.
Small Business Enterprise Minority or Woman-Owned Business Enterprise

Supplier:  AAT BIOQUEST INC
Description:   The Cell Meter™ Cell Adhesion Assay Kit is a fast and sensitive assay for measuring cell-cell or cell-surface adhesion for a variety of cell types.
Small Business Enterprise Minority or Woman-Owned Business Enterprise
Catalog Number: (76483-470)

Supplier:  AAT BIOQUEST INC
Description:   It has similar calcium binding properties to those of calcein.
Small Business Enterprise Minority or Woman-Owned Business Enterprise
Catalog Number: (103003-156)

Supplier:  Anaspec Inc
Description:   AM (22-52) is known as an adrenomedullin receptor antagonist and a cardiac depressant factor, although there is some discrepancy in the literature regarding the selectivity of ADM 22-52 as adrenomedullin receptor antagonist.
Sequence:TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2
MW:3576 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Catalog Number: (89365-618)

Supplier:  Genetex
Description:   Reacts with fluorescein isothiocyanate. Avidity against FITC conjugated BSA is 2 x 1010M-1. This antibody binds to both Free FITC and FITC conjugated to proteins, and may be valuable for amplification of FITC based immunostaining.
Catalog Number: (76644-598)

Supplier:  Draeger
Description:   An assortment of hood/helmet PAPR kits.
Environmentally Preferable
Supplier:  Tosoh Bioscience
Description:   TSK-Gel® Amide-80 are stainless steel columns with non-ionic carbamoyl [-C(NH₂)O] groups on a silica gel basis.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
-15 - 0  of 940
Prev   1  2  3  4  5  6  7  8  9  10  11  12  13  14  15