Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

Fmoc-2-amino-2-indancarboxylic+acid


157,560  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"157560"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Catalog Number: (10116-570)

Supplier:  Prosci
Description:   Polyclonal; Host: Goat; Immunogen: RANBP9 antibody was raised against a 13 amino acid synthetic peptide near the C-Terminus of RANBP9; Application: ELISA
Catalog Number: (10112-622)

Supplier:  Prosci
Description:   Polyclonal, Host: Goat, Immunogen: FBXL12 antibody was raised against a 12 amino acid synthetic peptide near the C-Terminus of FBXL12,Application: ELISA
Catalog Number: (ALA151515-5G)

Supplier:  ALADDIN SCIENTIFIC
Description:   3-Amino-5-phenylpyrazole ((3-phenyl-1H-pyrazol-5-amine) may be used in the synthesis of the following: · Urea derivatives by reaction with azido(6-(benzofuran-2-yl)-2-methylpyridin-3-yl) methanone. · 2-Mercaptoacetamide analogs by treating with thioglycolic acid. · 3-(Substituentpyrimidayl)-5,6-benzocoumarins by treating with 3-(2′-formyl-1′-chlorovinyl)-5,6-benzocoumarin. · Substituted 2,7-diphenylpyrazolo[1,5-a]pyrimidine-5-carboxylic esters by reacting with substituted β-diketo esters. · N-ethoxycarbonylthiourea derivative by reacting with ethoxycarbonyl isothiocyanate. · Heterobiaryl pyrazolo[3,4-b]pyridines by reacting with indole-3-carboxaldehyde.
New Product
Catalog Number: (AAH63614-06)

Supplier:  Thermo Scientific Chemicals
Description:   N-Fmoc-O-tert-butyl-N-methyl-L-serine, 97%
MSDS SDS

Supplier:  Anaspec Inc
Description:   This peptide is PACAP (1-38) with a Biotin label on its N-terminus. Pituitary adenylate cyclase-activating polypeptide (PACAP), a member of the vasoactive intestinal peptide/secretin/glucagon family, has an amino acid sequence identity of 68% with vasoactive intestinal polypeptide (VIP). PACAP38, derived from a 176-amino acid precursor (preproPACAP), is a 38-amino acid peptide discovered as an ovine hypothalamic neuropeptide. The amino acid sequence of PACAP is identical in all mammals, and in species such as chicken, frog, salmon, only 1–3 amino acids are different. It is abundant in both the central and peripheral nervous systems and exerts a variety of effects. PACAP in pancreatic islets may play a parasympathetic and sensory neurotransmitter role. PACAP stimulates insulin secretion from islets in a glucose-dependent manner at femtomolar concentrations, acting as an insulinotropic factor. PACAP and VIP are two multifunctional neuropeptides modulating innate and adaptive immunity. VIP/PACAP protect T cells from activation-induced cell death through down-regulation of Fas ligand. PACAP immunoreactivity has been shown in nerve fibers innervating the intrapancreatic ganglia as well as the islets of Langerhans in pancreas. PACAP (1-38) is more active than VIP in stimulating adenylate cyclase EC50=7 nM.
Sequence: HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKK(Biotin)-NH2
MW: 4888.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier:  Bioss
Description:   The protein encoded by ANP32C is one of at least two proteins that are similar in amino acid sequence to PP32 and are part of the same acidic nuclear phosphoprotein gene family. However, unlike PP32, the encoded protein is tumorigenic. The tumor suppressor function of PP32 has been localized to a 25 amino acid region that is divergent between PP32 and the protein encoded by this gene. This gene does not contain introns.

Supplier:  Bioss
Description:   The protein encoded by ANP32C is one of at least two proteins that are similar in amino acid sequence to PP32 and are part of the same acidic nuclear phosphoprotein gene family. However, unlike PP32, the encoded protein is tumorigenic. The tumor suppressor function of PP32 has been localized to a 25 amino acid region that is divergent between PP32 and the protein encoded by this gene. This gene does not contain introns.
Catalog Number: (10072-844)

Supplier:  Prosci
Description:   IL-19 belongs to the IL-10 family of regulatory cytokines which includes IL-10, IL-19, IL-20, IL-22, IL-24 and IL-26. Members of this family share partial homology in their amino acid sequences but they are dissimilar in their biological functions. Preliminary data suggests that IL-19 is a proinflammatory cytokine because it up-regulates IL-6 and TNF-α and induces apoptosis through TNF-α. IL-19 signals through the type I IL-20R. Human and murine IL-19 share 71% amino acid sequence identity. Recombinant human IL-19 is a 17.9 kDa protein containing 153 amino acid residues. In solution IL-19 exists predominantly as a non-disulfide-linked dimer.
Catalog Number: (103007-460)

Supplier:  Anaspec Inc
Description:   This is amino acids 17 to 41 fragment of lactoferrin, known as lactoferricin B. This peptide exhibits anti-fungal properties in combination of other anti-fungal agents. Candida Albicans is one of the targets of the lactoferricin B.
Sequence:FKCRRWQWRMKKLGAPSITCVRRAF (S-S BOND)
MW:3123.9 Da
% peak area by HPLC:95
Storage condition:-20° C
Supplier:  Adipogen
Description:   AMCA-H NHS ester reacts with primary amine groups on antibodies, proteins, peptides and other biomolecules at pH 7.0-9.0. Suitable for labeling lysyl residues in proteins (Ex/Em: 353/455nm).
Supplier:  Bachem Americas
Description:   Sequence: Fmoc-Val-OSu

Supplier:  United Scientific Supplies
Description:   These large and colorful DNA, mRNA, ribosome, tRNA, and amino acid models are visible anywhere in the classroom.
Supplier:  PeproTech, Inc.
Description:   Proteases (also called Proteolytic Enzymes, Peptidases, or Proteinases) are enzymes that hydrolyze the amide bonds within proteins or peptides. Most proteases act in a specific manner, hydrolyzing bonds at, or adjacent to, specific residues, or a specific sequence of residues contained within the substrate protein or peptide. Proteases play an important role in most diseases and biological processes, including prenatal and postnatal development, reproduction, signal transduction, the immune response, various autoimmune and degenerative diseases, and cancer. They are also an important research tool, frequently used in the analysis and production of proteins. Enterokinase sequentially cleaves carboxyl side of D-D-D-D-K. Human Enterokinase is expressed as a linear 1019 amino acid polypeptide precursor glycoprotein. Proteolytic processing of this precursor generates the biologically active form of Enterokinase, which consists of two polypeptide chains (heavy chain and light chain) held together by a single disulfide bond, resulting in formation of a biologically active heterodimer. The heavy chain consists of 784 amino acid residues, and the light chain consists of 235 amino acid residues. The calculated molecular weight of Recombinant Human Enterokinase is 108.7 kDa.
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 041545-5G , MDL Number: MFCD00672567
Catalog Number: (10113-670)

Supplier:  Prosci
Description:   Polyclonal, Host: Goat, Immunogen: TRPV2 antibody was raised against a 13 amino acid synthetic peptide near the C-Terminus of TRPV2, Tested Applications: ELISA
Supplier:  Bachem Americas
Description:   Enterotoxigenic E.coli are able to produce several toxic peptides which may cause acute diarrhea in humans and domestic animals. The E.coli heat-stable enterotoxin STp is syntheszied in vivo as a 72 amino acid precursor consisting of pre-, pro-, and mature region. Mature STp is composed of 18 amino acids containing three intramolecular disulfide bonds, which seem to be important for the correct conformation of the biologically active structure.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
7,057 - 7,072  of 157,560