Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

Fmoc-2-amino-2-indancarboxylic+acid


157,560  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"157560"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  MP Biomedicals
Description:   Ethylene Glycol-bis-(beta-aminoethylether)-N,N,N',N'-tetraacetic Acid is a chelating agent. It is an inhibitor of alkaline phosphatase activity which is useful in ELISA reactions.
MSDS SDS
Supplier:  AFG BIOSCIENCE LLC
Description:   Mouse Branched-chain-amino-acid Aminotransferase, Mitochondrial(BCAT2) ELISA Kit
Catalog Number: (10062-648)

Supplier:  Prosci
Description:   15 amino acid peptide near the carboxy terminus of human PIBF1.
Supplier:  Anaspec Inc
Description:   This is amino acids 1 to 42 fragment of mouse and rat beta-amyloid. It differs from human beta-amyloid by three amino acid residues: Arg5, Tyr10, and His13. Residues in human beta-amyloid correspond to Gly5, Phe10, and Arg13 in mice and rat sequence.
Sequence: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 4418 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Supplier:  AMBEED, INC
Description:   Fmoc-L-β-homoproline 98%
New Product
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 041567-1G , MDL Number: MFCD00190877
Supplier:  Chem Impex International
Description:   Crosslinking agent for compounds carrying an amino group
Supplier:  Sino Biological
Description:   A DNA sequence encoding the Influenza A virus (A/California/04/2009 (H1N1)) neuraminidase (ACP41107.1) (Met 1-Lys 469) was expressed, the cell lysates are collected, and bio-activity was tested. There is an amino acid change from Asparagine to Serine (N295S mutation) in NA / Neuraminidase.
Supplier:  Supra Sciences
Description:   Solid supported primary amine utilized in solid phase synthesis for coupling amino acids at carboxyl terminus.
MSDS SDS
Catalog Number: (103613-762)

Supplier:  Sino Biological
Description:   MUSK Kinase Protein (aa 433-783, His & GST Tag) Recombinant, Purity: > 90 % as determined by SDS-PAGE, Host: Baculovirus-Insect Cells, Species: Human, Immunogen: consists of 588 amino acids and has a calculated molecular mass of 68 kDa, size: 50 ug
Supplier:  Promega Corporation
Description:   Recombinant human ROCK1 (amino acids 17-535) was expressed by baculovirus in Sf9 insect cells using an N-terminal GST tag. ROCK1 is a ubiquitously expressed serine-threonine kinase that is a downstream target of the small GTPase RhoA.
Catalog Number: (10112-214)

Supplier:  Prosci
Description:   Polyclonal, Host: Goat, Species: Human, Immunogen: DPM1 antibody was raised against a 14 amino acid synthetic peptide near the N-Terminus of DPM1, Application: ELISA, WB
Catalog Number: (10112-686)

Supplier:  Prosci
Description:   Polyclonal, Host: Goat, Species: Human, Immunogen: FOXP4 antibody was raised against a 14 amino acid synthetic peptide near the N-Terminus of FOXP4, Application: ELISA, WB
Catalog Number: (10114-416)

Supplier:  Prosci
Description:   Polyclonal, Host: Goat; Target Species: Human; Immunogen: SMC2 antibody was raised against a amino acid synthetic peptide near the of SMC2; Applications: ELISA,Western blotting
Catalog Number: (10112-198)

Supplier:  Prosci
Description:   Polyclonal, Host: Goat, Immunogen: HRASLS antibody was raised against a 12 amino acid synthetic peptide near the internal region of HRASLS, Application: ELISA
Supplier:  MilliporeSigma
Description:   Cas Number:25102-12-9 25G
MSDS SDS
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
7,313 - 7,328  of 157,560