Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

Fmoc-2-amino-2-indancarboxylic+acid


170,336  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"170336"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  MilliporeSigma
MSDS SDS
Supplier:  AMBEED, INC
Description:   2-(3-(3,4-Dimethoxyphenyl)acrylamido)benzoic acid, Purity: 99+%, CAS Number: 53902-12-8, Appearance: Form: Crystal - Powder / Colour: Slightly pale yellow - Pale yellow green - Yellow, Storage: Keep in dark place, Inert atmosphere, Room temperature, Size: 25G
Supplier:  AMBEED, INC
Description:   Boc-Dab(Fmoc)-OH, Purity: 97%, CAS Number: 117106-21-5, Appearance: White to off-white powder or crystals, Storage: Keep in dark place, Inert atmosphere, Room temperature, Size: 10g
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 041509-5G , MDL Number: MFCD01320876
Supplier:  Ricca Chemical
Description:   Sulfanilamide reagent 1% (w/v) in hydrochloric acid 10%
MSDS SDS
Small Business Enterprise
Catalog Number: (103006-440)

Supplier:  Anaspec Inc
Description:   This peptide is from amino acid 3-42 of the full length 42-amino acid long GIP (Glucose-dependent Insulinotropic Polypeptide or also known as Gastric Inhibitory Polypeptide). The in-vivo degradation of the first two N-terminal amino acids (Tyr-Ala) by the enzyme dipeptidyl peptidase IV (DPP IV) results in making GIP (3-42) a potent antagonist as opposed to the agonist full length GIP on the GIP receptor.
Sequence: EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
MW: 4759.4 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier:  TCI America
Description:   CAS Number: 2922-83-0
MDL Number: MFCD00069912
Molecular Formula: C10H12N2O3
Molecular Weight: 208.22
Purity/Analysis Method: >98.0% (T)
Form: Crystal
Specific rotation [a]20/D: -33 deg (C=0.4, H2O)
MSDS SDS
Supplier:  Spectrum Chemicals
Description:   L-Proline, also known simply as proline, is a DNA-encoded amino acids and can be used as a asymmetric catalyst in organic reactions.
MSDS SDS
Supplier:  Thermo Scientific Chemicals
Description:   5G
MSDS SDS
Catalog Number: (10103-072)

Supplier:  Prosci
Description:   BAAT is a liver enzyme that catalyzes the transfer of C24 bile acids from the acyl-CoA thioester to either glycine or taurine, the second step in the formation of bile acid-amino acid conjugates. The bile acid conjugates then act as a detergent in the gastrointestinal tract, which enhances lipid and fat-soluble vitamin absorption. Defects in this gene are a cause of familial hypercholanemia (FHCA). The protein encoded by this gene is a liver enzyme that catalyzes the transfer of C24 bile acids from the acyl-CoA thioester to either glycine or taurine, the second step in the formation of bile acid-amino acid conjugates. The bile acid conjugates then act as a detergent in the gastrointestinal tract, which enhances lipid and fat-soluble vitamin absorption. Defects in this gene are a cause of familial hypercholanemia (FHCA). Two transcript variants encoding the same protein have been found for this gene.
Supplier:  AMBEED, INC
Description:   (S)-N-3-Cyanophenylalanine 98%
Supplier:  AMBEED, INC
Description:   Z-D-Gln(Trt)-OH 97%
Supplier:  Invitrogen
Description:   Fluoraldehyde crystals are o-phthalaldehyde (OPA), a highly sensitive fluorescent derivatization reagent for peptide or amino acid detection and quantitation in HPLC.
Supplier:  TCI America
Description:   CAS Number: 644-90-6
MDL Number: MFCD00008102
Molecular Formula: C8H17NO2
Molecular Weight: 159.23
Purity/Analysis Method: >98.0% (T)
Form: Crystal
MSDS SDS
Catalog Number: (10108-986)

Supplier:  Prosci
Description:   SLC38A4 is found predominantly in liver and transports both cationic and neutral amino acids. The transport of cationic amino acids by SLC38A4 is Na (+) and pH independent, while the transport of neutral amino acids is Na (+) and pH dependent.The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. Four alternatively spliced transcript variants encoding the same protein have been found for this gene.
Supplier:  Thermo Scientific Chemicals
Description:   3-[N-Tris-(hydroxymethyl)methylamino]-2-hydroxypropanesulfonic acid, Cas Number: 68399-81-5, Molecular Formula: C7H17NO7S, Molecular Weight: 259.28, Melting point: 220-222 deg C, Synonym: TAPSO, Size: 25g
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
7,969 - 7,984  of 170,336