Text Search >
Fmoc-D-Lys(Fmoc)-OH
Print…
You Searched For:
22,904 results were found
Fmoc-D-Lys(Fmoc)-OH
Catalog Number:
(TCC1728-5G)
Supplier:
TCI America
Description:
CAS Number: 2212-75-1
MDL Number: MFCD00038204 Molecular Formula: C14H20N2O4 Molecular Weight: 280.32 Purity/Analysis Method: >97.0% (HPLC,T) Form: Crystal Specific rotation [a]20/D: -13 deg (C=2, 0.2mol/L HCl)
Catalog Number:
(102996-536)
Supplier:
Anaspec Inc
Description:
β-Endorphin is an endogenous opioid neuropeptide found in the neurons of both the central and peripheral nervous system.
Sequence:YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE MW:3465.1 Da % peak area by HPLC:95 Storage condition:-20° C
Supplier:
Bachem Americas
Description:
Reaction of the dipeptide KY with diethylenetriaminepentaacetic (DTPA) cyclic anhydride yielded monovalent and bivalent haptens. In vitro, the antibody conjugate (which was prepared by coupling F(ab’)2 or Fab’ fragments of an antibody specific for the human high molecular weight melanoma associated antigen to Fab’ fragments of an antibody specific for In-DTPA complexes) mediated binding of the ¹¹¹In-labeled haptens to melanoma cells. In vivo, it allowed specific localization of the haptens in A375 tumors. The bivalent hapten exhibited much higher efficiency at targeting ¹¹¹In onto cells, both in vitro and in vivo.
Catalog Number:
(103003-222)
Supplier:
Anaspec Inc
Description:
Peptide sequence KVEKIGEGTYGVVYK is derived from the amino acid residues CDC26-20. It is considered to be a generic substrate for various TPKs.
Sequence:KVEKIGEGTYGVVYK MW:1669.9 Da % peak area by HPLC:95 Storage condition:-20° C
Catalog Number:
(103006-262)
Supplier:
Anaspec Inc
Description:
This peptide is a HLA-DRB 0101-restricted epitope from Influenza hemagglutinin (307-319).
Sequence:PKYVKQNTLKLAT MW:1503.8 Da % peak area by HPLC:95 Storage condition:-20° C
Supplier:
Anaspec Inc
Description:
GIP (Glucose-dependent Insulinotropic Polypeptide or also known as Gastric Inhibitory Polypeptide) is a 42-amino acid peptide released by the K cells of the duodenum and jejunum in response to food intake. GIP, together with GLP (Gastric-like Peptide) are members of the hormone peptide family of Incretins which stimulate insulin secretion from pancreatic islet β-cells, and also appears to promote beta cell proliferation and beta cell survival. Recent studies suggest that GIP plays a role in lipid homeostasis and possibly in the pathogenesis of obesity.
Sequence: YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKNDWKHNLTQ MW: 5002.95 Da % Peak area by HPLC: 95 Storage condition: -20° C
Catalog Number:
(103002-946)
Supplier:
Anaspec Inc
Description:
The native peptide PKTPKKAKKL (60026-1) is derived from histone H1 peptide sequence that is docked in the active site of cyclin-dependent kinase 5. It is an effective CDK5 substrate (Km = 40 µM).
Sequence:PKTPKKAKKL MW:1138.5 Da % peak area by HPLC:95 Storage condition:-20° C
Catalog Number:
(102999-808)
Supplier:
Anaspec Inc
Description:
Sequence: KKPYIL
MW: 761 Da % peak area by HPLC: 95% Storage condition: -20°C
Supplier:
Thermo Scientific Chemicals
Description:
MDL: MFCD00064563
Beilstein Registry No.: 4711993
Supplier:
Bachem Americas
Description:
Please see also α-MSH (corresponds to acetyl-ACTH (1-13) amide, H-1075), α-MSH (free acid) (acetyl-ACTH (1-13), H-1070), and (Des-acetyl)-α-MSH (H-4390). Wied: Pituitary Adrenal System Hormones and Behaviour. Symposium on Developments in Endocrinology (1976) / Anon.: ACTH and Related Peptides: Structure, Regulation, and Action. Ann. N.Y. Acad. Sci. 297, 1 (1977) / A.V.Schally: Aspects of Hypothalamic Regulation of the Pituitary Gland. Science 202, 18 (1978) / R.Schwyzer: Studies on Polypeptide Receptors. A Critical View on the Mechanism of ACTH Action. Bull. Schweiz. Acad. Med. Wiss. 34, 263 (1978).
Supplier:
Bachem Americas
Description:
Please see also α-MSH (corresponds to acetyl-ACTH (1-13) amide, H-1075), α-MSH (free acid) (acetyl-ACTH (1-13), H-1070), and (Des-acetyl)-α-MSH (H-4390). Wied: Pituitary Adrenal System Hormones and Behaviour. Symposium on Developments in Endocrinology (1976) / Anon.: ACTH and Related Peptides: Structure, Regulation, and Action. Ann. N.Y. Acad. Sci. 297, 1 (1977) / A.V.Schally: Aspects of Hypothalamic Regulation of the Pituitary Gland. Science 202, 18 (1978) / R.Schwyzer: Studies on Polypeptide Receptors. A Critical View on the Mechanism of ACTH Action. Bull. Schweiz. Acad. Med. Wiss. 34, 263 (1978).
Supplier:
Matrix Scientific
Description:
MF=C6H15CLN2O2 MW=182.65 CAS=70-53-1 MDL=MFCD00064563 100G
Supplier:
Bachem Americas
Description:
PG 99-465 is a high affinity, selective VPAC2 receptor antagonist. It exhibited a 100-fold preference for the VPAC2 over the VPAC1 receptor. The compound showed partial agonistic activity on the VPAC1 receptor and was inactive on the VPAC2 receptor transfected in CHO cells, as well as on naturally expressed human VPAC2 receptors in the SUP T1 cell line. Dickson et al. observed an agonistic effect of PG99-465 on the human VPAC1 and PAC1 receptors. When applied singly, PG99-465 increased [cAMP](i) at all three hVPAC/PAC receptor subtypes.
Supplier:
Bachem Americas
Description:
Please see also α-MSH (corresponds to acetyl-ACTH (1-13) amide, H-1075), α-MSH (free acid) (acetyl-ACTH (1-13), H-1070), and (Des-acetyl)-α-MSH (H-4390). Wied: Pituitary Adrenal System Hormones and Behaviour. Symposium on Developments in Endocrinology (1976) / Anon.: ACTH and Related Peptides: Structure, Regulation, and Action. Ann. N.Y. Acad. Sci. 297, 1 (1977) / A.V.Schally: Aspects of Hypothalamic Regulation of the Pituitary Gland. Science 202, 18 (1978) / R.Schwyzer: Studies on Polypeptide Receptors. A Critical View on the Mechanism of ACTH Action. Bull. Schweiz. Acad. Med. Wiss. 34, 263 (1978).
Supplier:
Bachem Americas
Description:
Heavy isotope-labeled Glucagon useful for pharmacokinetic/pharmacodynamic studies in combination with Bachem product H-6790 Glucagon (1-29) (human, rat, porcine) or the corresponding generic API (Glucagon).
Catalog Number:
(103003-356)
Supplier:
Anaspec Inc
Description:
ACTH (1–17), and aMSH (a-Melanotropin), both derived from POMC (proopiomelanocortin) are involved in melanogenesis. However, ACTH (1-17) has been found to be more potent in malanogenesis in human malanocytes. Both ACTH (1-17) and aMSH also increase dendricity, and proliferation in follicular melanocytes.
Sequence: SYSMEHFRWGKPVGKKR MW: 2093.4 Da % Peak Area by HPLC: ≥ 95% Storage condition: -20°C
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
 is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||
List View
