Text Search >
Fmoc-D-Lys(Fmoc)-OH
Print…
You Searched For:
23,824 results were found
Fmoc-D-Lys(Fmoc)-OH
Catalog Number:
(100244-108)
Supplier:
Southern Biotechnology
Description:
The monoclonal antibody 34-5-8S reacts with a conformational epitope on H-2Dd MHC Class I found on the N-terminal domains of α1 and α2 chains when complexed with β2-microglobulin. The antibody does not react with H-2Dd α chains synthesized in vitro. Weak cross-reactivity with cells from mice of the H-2b, H-2q, and H-2s haplotypes has been observed by flow cytometric analysis. Reactivity with cells from mice of the H-2f, H-2k, H-2p, and H-2r haplotypes has not been observed. 34-5-8S has been reported to block the recognition of H-2Dd by Ly-49A+, Ly-49C+, and Ly-49G2+ natural killer cells.
Supplier:
Bachem Americas
Description:
Hepsin, a membrane-anchored serine protease, is overexpressed in ovarian and prostate cancer and in renal cell carcinoma and thus can serve as prognostic marker. Ac-KQLR-AFC is the optimal substrate for human hepsin, as KQLR / VVNG corresponds to its cleavage site. Excitation at 395-400 nm, emission at 495-505 nm.
Supplier:
Promega Corporation
Description:
ProteaseMAXâ„¢ surfactant, trypsin enhancer enhances the enzymatic performance of trypsin, chymotrypsin and Lys-C in digestion reactions.
Catalog Number:
(10765-746)
Supplier:
Prosci
Description:
The RB6-8C5 monoclonal antibody reacts with the mouse Ly-6G (also known as Gr-1). The Ly-6G protein is a myeloid differentiation antigen of 21-25 kDa, expressed in a regulated manner by the myeloid lineage in the bone marrow, where the level of antigen expression is correlated with the granulocyte maturation and differentiation. In the bone marrow, the antigen is not expressed by the erythroid cells. From the peripheric cells, RB6-8C5 binds with monocytes, neutrophils and eosinophils.As a marker for the mouse monocytes, macrophages and granulocytes, the RB6-8C5 antibody is usually combined with M1/70, a macrophage labeling antibody (Anti-CD11b), for phenotypic analysis.
Catalog Number:
(10429-286)
Supplier:
Bioss
Description:
Distributive alpha-N-methyltransferase that methylates the N-terminus of target proteins containing the N-terminal motif [Ala/Pro/Ser]-Pro-Lys when the initiator Met is cleaved. Specifically catalyzes mono-, di- or tri-methylation of exposed alpha-amino group of Ala or Ser residue in the [Ala/Ser]-Pro-Lys motif and mono- or di-methylation of Pro in the Pro-Pro-Lys motif. Some of the substrates may be primed by METTL11B-mediated monomethylation. Responsible for the N-terminal methylation of KLHL31, MYL2, MYL3, RB1, RCC1, RPL23A and SET. Required during mitosis for normal bipolar spindle formation and chromosome segregation via its action on RCC1.
Catalog Number:
(103007-358)
Supplier:
Anaspec Inc
Description:
This is amino acids 1 to 28 fragment of the b-amyloid peptide biotinylated on the side chain of lysine.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNK-K(Biotin)-NH2 Molecular Weight: 3616 Da % Peak Area by HPLC: ≥95 Peptide Content: ≥ 60% Storage condition: -20°C
Catalog Number:
(10429-276)
Supplier:
Bioss
Description:
Distributive alpha-N-methyltransferase that methylates the N-terminus of target proteins containing the N-terminal motif [Ala/Pro/Ser]-Pro-Lys when the initiator Met is cleaved. Specifically catalyzes mono-, di- or tri-methylation of exposed alpha-amino group of Ala or Ser residue in the [Ala/Ser]-Pro-Lys motif and mono- or di-methylation of Pro in the Pro-Pro-Lys motif. Some of the substrates may be primed by METTL11B-mediated monomethylation. Responsible for the N-terminal methylation of KLHL31, MYL2, MYL3, RB1, RCC1, RPL23A and SET. Required during mitosis for normal bipolar spindle formation and chromosome segregation via its action on RCC1.
Catalog Number:
(103650-162)
Supplier:
Sino Biological
Description:
Produced in rabbits immunized with purified, recombinant Human SOD2 (rh SOD2; Catalog#12656-HNAE; P04179-1; Lys 25-Lys 222). SOD2 specific IgG was purified by Human SOD2 affinity chromatography.
Catalog Number:
(126602-BL)
Supplier:
Biolegend
Description:
Purified anti-mouse CD8b (Ly-3) [YTS156.7.7]; Isotype: Rat IgG2b, κ; Reactivity: Mouse; Apps: FC, IF; Size: 500 μg
Supplier:
ACROBIOSYSTEMS INC MS
Description:
Onchocerca volvulus OV16 protein, GST Tag, Source: expressed from E.coli cells. It contains AA Lys 17 - Asp 197, Predicted N-terminus: Met, protein carries a GST tag at the N-terminus, Synonyms: OV16, OV-16 antigen, Size: 100uG
Catalog Number:
(77236-342)
Supplier:
AMBEED, INC
Description:
(S)-8-(5-(2-Hydroxypropan-2-yl)pyridin-3-yl)-1-(2-methoxypropyl)-3-methyl-1,3-dihydro-2H-imidazo[4,5-c]quinolin-2-one, Purity: 98+%, CAS Number: 1386874-06-1, Appearance: Light yellow solid, Storage: Inert atmosphere, Store in freezer, under -20 C, Size: 50mg
Catalog Number:
(10405-346)
Supplier:
Bioss
Description:
NAD-dependent protein deacetylase. Has deacetylase activity towards 'Lys-9' and 'Lys-56' of histone H3. Modulates acetylation of histone H3 in telomeric chromatin during the S-phase of the cell cycle. Deacetylates 'Lys-9' of histone H3 at NF-kappa-B target promoters and may down-regulate the expression of a subset of NF-kappa-B target genes. Deacetylation of nucleosomes interferes with RELA binding to target DNA. May be required for the association of WRN with telomeres during S-phase and for normal telomere maintenance. Required for genomic stability. Required for normal IGF1 serum levels and normal glucose homeostasis. Modulates cellular senescence and apoptosis. Regulates the production of TNF protein.
Catalog Number:
(103662-976)
Supplier:
Sino Biological
Description:
A DNA sequence encoding the human LY6D (CAA73189.1) (Met1-His97) was expressed with the Fc region of mouse IgG1 at the C-terminus.
Catalog Number:
(103008-276)
Supplier:
Anaspec Inc
Description:
This peptide corresponds to amino acids 26 to 46 of human histone H3. It is dimethylated at lysine-36, followed by a biotinylated lysine. The methylation of histone H3 at lysine 36 (K36) has recently been shown to be associated with RNA polymerase II (Pol
Sequence:RKAAPATGGV-K(Me2)-KPHRYRPGTV-K(Biotin) MW:2630.1 Da % peak area by HPLC:95 Storage condition:-20° C
Catalog Number:
(89333-620)
Supplier:
Genetex
Description:
Clone: 39266 Species Reactivity: Mouse Pkg Size: 100 test
Catalog Number:
(89307-196)
Supplier:
Genetex
Description:
Clone: 39266 Species Reactivity: Mouse Pkg Size: 25 ug
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
 is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||
List View
