Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

You Searched For:

4-Bromo-2,3-dimethylphenylboronic acid


22,189  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"22189"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 


Supplier:  Sino Biological
Description:   This antibody was obtained from a rabbit immunized with purified, recombinant Human GFRA3 (rh GFRA3; Catalog#10213-H08H; NP_001487.2; Met 1-Trp 382).
Catalog Number: (10255-622)

Supplier:  Bioss
Description:   Very active and specific thyroid hormone transporter. Stimulates cellular uptake of thyroxine (T4), triiodothyronine (T3), reverse triiodothyronine (rT3) and diidothyronine. Does not transport Leu, Phe, Trp or Tyr (By similarity).

Supplier:  Sino Biological
Description:   This antibody was produced from a hybridoma resulting from the fusion of a mouse myeloma with B cells obtained from a mouse immunized with purified, recombinant Human CD10 / Neprilysin / MME (rh CD10 / Neprilysin / MME; Catalog#10805-H07H; NP_000893.2; Tyr 52-Trp 750). The IgG fraction of the cell culture supernatant was purified by Protein A affinity chromatography.

Supplier:  Sino Biological
Description:   This antibody was produced from a hybridoma resulting from the fusion of a mouse myeloma with B cells obtained from a mouse immunized with purified, recombinant Human PARP-1 / PARP (rh PARP-1 / PARP; Catalog#11040-H08B; NP_001609.2; Met 1-Trp 1014). The IgG fraction of the cell culture supernatant was purified by Protein A affinity chromatography.
Catalog Number: (76818-326)

Supplier:  AMBEED, INC
Description:   2-Amino-3-(7H-pyrrolo[2,3-b]pyridin-3-yl)propanoic acid, Purity: 98%, CAS Number: 7303-50-6, Appearance: Solid, Storage: Keep in dark place, Sealed in dry, Store in freezer, under -20C, Size: 100MG
Catalog Number: (10751-850)

Supplier:  Prosci
Description:   TRPV1 Antibody: TRPV1 is a receptor for capsaicin, the main pungent ingredient in hot chili peppers, and elicits a sensation of burning pain by selectively activating sensory neurons. TRPV1 is a non-selective cation channel that is structurally related to members of the TRP family of ion channels such as TRPC3 and TRPC6. This receptor is also activated by increases in temperature in the noxious range, suggesting that it functions as a transducer of painful thermal stimuli in vivo.
Catalog Number: (H-6404.0005BA)

Supplier:  Bachem Americas
Description:   LHRH is also called Gonadotropin-Releasing Hormone (GnRH) or Luteinizing Hormone-Releasing Factor (LRF).

Supplier:  Biotium
Description:   This antibody recognizes a cluster of proteins between 70-80 kDa, identified as tyrosinase. Occasionally a minor band at 55 kDa is also detected. This MAb shows no cross-reaction with MAGE-1 and tyrosinase-related protein 1, TRP-1/gp75. Tyrosinase is a copper-containing metalloglycoprotein that catalyzes several steps in the melanin pigment biosynthetic pathway; the hydroxylation of tyrosine to L-3,4-dihydroxy-phenylalanine (dopa), and the subsequent oxidation of dopa to dopaquinone. Mutations of the tyrosinase gene occur in various forms of albinism. Tyrosinase is one of the targets for cytotoxic T-cell recognition in melanoma patients. Staining of melanomas with this MAb shows tyrosinase in melanotic as well as amelanotic variants. This MAb is a useful marker for melanocytes and melanomas.
Catalog Number: (102997-152)

Supplier:  Anaspec Inc
Description:   HLA-B*3501 restricted influenza virus nucleoprotein epitope (383-391).
Sequence: SRYWAIRTR
MW: 1208.4 Da
% Peak area by HPLC: 95
Storage condition: -20°C
Supplier:  MP Biomedicals
Description:   N-acetyl-DL-tryptophan, is used as stabilizer in the human blood-derived therapeutic products normal serum albumin and plasma protein fraction.
Supplier:  Bachem Americas
Description:   Heavy isotope-labeled Glucagon useful for pharmacokinetic/pharmacodynamic studies in combination with Bachem product H-6790 Glucagon (1-29) (human, rat, porcine) or the corresponding generic API (Glucagon).
Catalog Number: (75789-236)

Supplier:  Prosci
Description:   There exists two types of tryptophanyl tRNA synthetases, the cytoplasmic form called WARS, the mitochondrial form called WARS2. WARS catalyzes the aminoacylation of tRNA (trp) with tryptophan and is induced by interferon. WARS regulates ERK, Akt, eNOS activation pathway, which are related with angiogenesis, cytoskelatal reorganization and shear stess-reponsive gene expression.
Supplier:  Bachem Americas
Description:   The FRET substrate Mca-RPKPYA-Nva-WMK(Dnp)-amide was hydrolyzed 60 times more rapidly by stromelysin 1 (MMP-3) (kcat/Km= 59400 M⁻¹s⁻¹) than by interstitial collagenase (MMP-1). However, it showed little discrimination between MMP-3, gelatinase A (MMP-2) (kcat/Km= 54000 M⁻¹s⁻¹), and gelatinase B (MMP-9) (kcat/Km= 55300 M⁻¹s⁻¹). Metalloelastase (MMP-12) digested this fluorogenic substrate with a kcat/Km of 243000 M⁻¹s⁻¹. For a fluorescent standard see M-2250.
Supplier:  Anaspec Inc
Description:   GIP (Glucose-dependent Insulinotropic Polypeptide or also known as Gastric Inhibitory Polypeptide) is a 42-amino acid peptide released by the K cells of the duodenum and jejunum in response to food intake. GIP, together with GLP (Gastric-like Peptide) are members of the hormone peptide family of Incretins which stimulate insulin secretion from pancreatic islet β-cells, and also appears to promote beta cell proliferation and beta cell survival. Recent studies suggest that GIP plays a role in lipid homeostasis and possibly in the pathogenesis of obesity.
Sequence: YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKNDWKHNLTQ
MW: 5002.95 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Catalog Number: (G-1775.0001BA)

Supplier:  Bachem Americas
Description:   Also known as dioxopiperazines, piperazine-2,5-diones or DKPs. Diketopiperazines may occur as by-products during peptide synthesis or during the degradation of peptides. These cyclic dipeptides have been detected as taste-modulating compounds in food, they often show biological activity. DKPs are valuable chiral synthons, employed e.g. in Schöllkopf's versatile bislactim ether approach. They also have found use as catalysts for enantioselective synthesis, e.g. in the asymmetric Strecker reaction. See also the TRH metabolite cyclo(-His-Pro), G-1745, and cyclo(-Asp-Phe), G-1695, the major degradation product of aspartame.

Supplier:  Adipogen
Description:   Non-cytotoxic melanogenesis inhibitor. Potential depigmentation agent. Tyrosinase-related protein 2 (TRP-2) expression inhibitor, via proteasomal degradation. Inhibits the proliferation of melanocytes and melanoma cells through cell cycle arrest in G1. Moderate skin tumor growth suppressor in vivo.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
17 - 32  of 22,189
  1  2  3  4  5  6  7  8  9  10  11  12  13  14  15  Next