Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results


SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"33994"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 


Supplier:  AFG BIOSCIENCE LLC
Description:   Mouse Beta-galactosidase,betaGAL ELISA Kit

Supplier:  Novus Biologicals
Description:   The ADA2 beta Antibody (1C8) from Novus Biologicals is a mouse monoclonal antibody to ADA2 beta. This antibody reacts with human, mouse, rat. The ADA2 beta Antibody (1C8) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin.

Supplier:  Genetex
Description:   Mouse monoclonal [6E10] to IL1 beta

Supplier:  Anaspec Inc
Description:   This is a fluorescent 5-FAM labeled scrambled Beta-Amyloid peptide, Abs/Em=494/521 nm.
Sequence: 5-FAM-AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA
MW: 4873.4
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Supplier:  AFG BIOSCIENCE LLC
Description:   Rat APBB3 (Amyloid Beta Precursor Protein Binding Protein B3) ELISA Kit
Supplier:  Novus Biologicals
Description:   The Proteasome subunit beta type 4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Proteasome subunit beta type 4. This antibody reacts with human, rat. The Proteasome subunit beta type 4 Antibody has been validated for the following applications: Western Blot.

Supplier:  ANTIBODIES.COM LLC
Description:   Human Thyroid Hormone Receptor beta ELISA kit is a 90 minutes sandwich Enzyme-Linked Immunosorbent Assay (sELISA) designed for the <i>in vitro</i> quantitative determination of human Thyroid Hormone Receptor beta in serum, plasma, and other biological fluids.

Supplier:  Novus Biologicals
Description:   The beta-Actin Antibody from Novus Biologicals is a rabbit polyclonal antibody to beta-Actin. This antibody reacts with human, mouse. The beta-Actin Antibody has been validated for the following applications: Western Blot, Simple Western, Immunohistochemistry, ICC / IF (Negative).

Supplier:  Novus Biologicals
Description:   The beta Adducin Antibody from Novus Biologicals is a rabbit polyclonal antibody to beta Adducin. This antibody reacts with human. The beta Adducin Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry / Immunofluorescence, Immunohistochemistry-Paraffin, Immunofluorescence.
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 042362-1G , MDL Number: MFCD01863209
Supplier:  Bioss
Description:   Transmembrane serine/threonine kinase forming with the TGF-beta type I serine/threonine kinase receptor, TGFBR1, the non-promiscuous receptor for the TGF-beta cytokines TGFB1, TGFB2 and TGFB3. Transduces the TGFB1, TGFB2 and TGFB3 signal from the cell surface to the cytoplasm and is thus regulating a plethora of physiological and pathological processes including cell cycle arrest in epithelial and hematopoietic cells, control of mesenchymal cell proliferation and differentiation, wound healing, extracellular matrix production, immunosuppression and carcinogenesis. The formation of the receptor complex composed of 2 TGFBR1 and 2 TGFBR2 molecules symmetrically bound to the cytokine dimer results in the phosphorylation and the activation of TGFRB1 by the constitutively active TGFBR2. Activated TGFBR1 phosphorylates SMAD2 which dissociates from the receptor and interacts with SMAD4. The SMAD2-SMAD4 complex is subsequently translocated to the nucleus where it modulates the transcription of the TGF-beta-regulated genes. This constitutes the canonical SMAD-dependent TGF-beta signaling cascade. Also involved in non-canonical, SMAD-independent TGF-beta signaling pathways.
Catalog Number: (76012-484)

Supplier:  Prosci
Description:   ANKRD6 recruits CKI-epsilon to the beta-catenin degradation complex that consists of AXN1 or AXN2 and GSK3-beta and allows efficient phosphorylation of beta-catenin, thereby inhibiting beta-catenin/Tcf signals (By similarity).
Supplier:  Novus Biologicals
Description:   The Protein Phosphatase 1 beta Antibody from Novus Biologicals is a rabbit polyclonal antibody to Protein Phosphatase 1 beta. This antibody reacts with human, mouse. The Protein Phosphatase 1 beta Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry / Immunofluorescence, Immunohistochemistry-Paraffin.
Catalog Number: (89278-926)

Supplier:  Genetex
Description:   Rabbit Polyclonal antibody to beta 3 Defensin (defensin beta 103B) Purity: Protein A purified Species Reactivity: Human Tested Applications: WB Pkg Size: 100 ug
Supplier:  Novus Biologicals
Description:   The TGF-beta 2 Antibody (MM0640-6M28) from Novus Biologicals is a mouse monoclonal antibody to TGF-beta 2. This antibody reacts with human. The TGF-beta 2 Antibody (MM0640-6M28) has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Catalog Number: (103517-150)

Supplier:  Acros Organics
Description:   Cytosine beta-D-arabinofuranoside, Purity: 98%, CAS Number: 147-94-4, Molecular Formula: C9H13N3O5, Formula Weight: 243.22g/mol, Synonyms: Ara-C, Cytosine beta-D-arabinofuranoside, Physical Form: Crystalline powder, Color: White to Beige, Size: 100mg
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
1 - 16  of 33,994