Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

Gal[236Bn]beta(1-4)Glc[236Bn]-beta-MP


33,993  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"33993"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Catalog Number: (10256-278)

Supplier:  Bioss
Description:   IL2 Receptor beta (CD122) is a member of the immunoglobulin superfamily that forms the high affinity IL2 receptor with CD25 and CD132. This receptor chain, which is also shared by the IL15 receptor, is constitutively expressed by NK cells and at lower levels by T cells, B cells, monocytes, and macrophages. The IL2 Receptor beta chain can combine with either the common gamma subunit (gamma c) alone or the gamma c subunit and the IL2 Receptor alpha subunit to generate intermediate or high affinity IL2 receptor complexes, respectively. CD122 levels can be upregulated by activation stimuli such as IL2.
Supplier:  ACROBIOSYSTEMS INC MS
Description:   Mouse Integrin alpha 10 beta 1 (ITGA10&ITGB1) Heterodimer Protein, His Tag&Tag Free, Source: expressed from HEK293, Predicted N-terminus: Phe 23 (ITGA10) & Gln 21 (ITGB1), Molecular weight: 126.6 kDa (ITGA10) and 83.5 kDa (ITGB1), Synonyms: Integrin alpha 10 beta 1, ITGA10&ITGB1, Size: 100uG
Catalog Number: (89306-708)

Supplier:  Genetex
Description:   Rabbit Polyclonal antibody to Integrin beta 1 (CD29)

Supplier:  Genetex
Description:   Mouse Monoclonal antibody [MBH90AB] to Hsp90 alpha,beta
Supplier:  Genetex
Description:   Mouse Monoclonal antibody [M11-14b-D10] to Defensin, beta-1 (a.a. 1-36)

Supplier:  Bioss
Description:   Nuclear hormone receptor. Binds estrogens with an affinity similar to that of ESR1, and activates expression of reporter genes containing estrogen response elements (ERE) in an estrogen-dependent manner. Isoform beta-cx lacks ligand binding ability and has no or only very low ere binding activity resulting in the loss of ligand-dependent transactivation ability. DNA-binding by ESR1 and ESR2 is rapidly lost at 37 degrees Celsius in the absence of ligand while in the presence of 17 beta-estradiol and 4-hydroxy-tamoxifen loss in DNA-binding at elevated temperature is more gradual.
Supplier:  Novus Biologicals
Description:   The CCL19 / MIP-3 beta Antibody (RM0171-10J38) from Novus Biologicals is a rat monoclonal antibody to CCL19 / MIP-3 beta. This antibody reacts with mouse. The CCL19 / MIP-3 beta Antibody (RM0171-10J38) has been validated for the following applications: Western Blot, Blocking / Neutralizing.
Supplier:  ANTIBODIES.COM LLC
Description:   Mouse monoclonal [TGFB/510] antibody to TGF beta for Functional Studies and ELISA with samples derived from Human, Monkey, Bovine, Canine, Mouse, Rat and Hamster.
Catalog Number: (10112-486)

Supplier:  Prosci
Description:   Polyclonal, Host: Goat, Species: Human, Immunogen: B56 beta antibody was raised against a 14 amino acid synthetic peptide near the C-Terminus of B56 beta, Application: ELISA, WB
Supplier:  AFG BIOSCIENCE LLC
Description:   Chicken Alpha/Beta Hydrolase Domain-Containing Protein 5 (ABHD5) ELISA Kit
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 041555-5G , MDL Number: MFCD00671389
Supplier:  Biotium
Description:   Estrogen Receptor beta 1 Monoclonal antibody, Clone: ESR2/686, Host: Mouse, Species reactivity: Human, Isotype: IgG's, Conjugate: CF640R, Immunogen: C-terminus fragment, Synonyms: Erb, ESR BETA, ESR2, Application: IF, IHC, WB, FC, Size: 100uL
Supplier:  Biotium
Description:   Estrogen Receptor beta 1 Monoclonal antibody, Clone: ESR2/686, Host: Mouse, Species reactivity: Human, Isotype: IgG's, Conjugate: CF594, Immunogen: C-terminus fragment, Synonyms: Erb, ESR BETA, ESR2, Application: IF, IHC, WB, FC, Size: 100uL
Catalog Number: (103007-602)

Supplier:  Anaspec Inc
Description:   Several mutations in the beta amyloid precursor gene cause autosomal dominant Alzheimer's Disease in a number of kindreds. Among them, the English mutation, with His at position 6 replaced with Arg, was reported to accelerate the kinetics of oligomers formation which act as fibril seeds and are more toxic to cultured neuronal cells.
Sequence: DAEFRRDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight: 4348.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier:  R&D Systems
Description:   IFN-alpha/beta R2 Polyclonal Antibody, Host: Goat, Reactivity: Mouse, Isotype: IgG, Format: Fluorescein, Immunogen: Mouse myeloma cell line NS0-derived recombinant mouse IFN-alpha / beta R2, Synonym: NK cell receptor, Application: Flow cytometry, Size: 100 Tests
Catalog Number: (77210-174)

Supplier:  ANTIBODIES.COM LLC
Description:   Mouse Estrogen Receptor beta ELISA kit is a 90 minutes sandwich Enzyme-Linked Immunosorbent Assay (sELISA) designed for the <i><i>in vitro</i></i> quantitative determination of mouse Estrogen Receptor beta in serum, plasma, and other biological fluids.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
2,929 - 2,944  of 33,993