Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

Gal[236Bn]beta(1-4)Glc[236Bn]-beta-MP


33,993  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"33993"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 


Supplier:  ANTIBODIES.COM LLC
Description:   Human beta 1 Adrenergic receptor ELISA kit is a sandwich Enzyme-Linked Immunosorbent Assay (sELISA) designed for the <i>in vitro</i> quantitative determination of human beta 1 Adrenergic receptor in serum, plasma, tissue homogenates, and other biological fluids.
Catalog Number: (77210-478)

Supplier:  ANTIBODIES.COM LLC
Description:   Human beta Glucuronidase/GUSB ELISA kit is a 90 minute sandwich Enzyme-Linked Immunosorbent Assay (sELISA) designed for the <i>in vitro</i> quantitative determination of human beta Glucuronidase/GUSB in serum, plasma, and other biological fluids.
Supplier:  AFG BIOSCIENCE LLC
Description:   Chicken Alpha/Beta Hydrolase Domain-Containing Protein 5 (ABHD5) ELISA Kit
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 041555-5G , MDL Number: MFCD00671389
Supplier:  Biotium
Description:   Estrogen Receptor beta 1 Monoclonal antibody, Clone: ESR2/686, Host: Mouse, Species reactivity: Human, Isotype: IgG's, Conjugate: CF640R, Immunogen: C-terminus fragment, Synonyms: Erb, ESR BETA, ESR2, Application: IF, IHC, WB, FC, Size: 100uL
Supplier:  Biotium
Description:   Estrogen Receptor beta 1 Monoclonal antibody, Clone: ESR2/686, Host: Mouse, Species reactivity: Human, Isotype: IgG's, Conjugate: CF594, Immunogen: C-terminus fragment, Synonyms: Erb, ESR BETA, ESR2, Application: IF, IHC, WB, FC, Size: 100uL
Catalog Number: (103007-602)

Supplier:  Anaspec Inc
Description:   Several mutations in the beta amyloid precursor gene cause autosomal dominant Alzheimer's Disease in a number of kindreds. Among them, the English mutation, with His at position 6 replaced with Arg, was reported to accelerate the kinetics of oligomers formation which act as fibril seeds and are more toxic to cultured neuronal cells.
Sequence: DAEFRRDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight: 4348.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Catalog Number: (89304-036)

Supplier:  Genetex
Description:   Rabbit Polyclonal antibody to GSK3 beta (Phospho Ser9)
Supplier:  Novus Biologicals
Description:   The CaMKII alpha / beta [p Thr287, p Thr286] Antibody (22B1) [DyLight 350] from Novus Biologicals is a mouse monoclonal antibody to CaMKII alpha / beta. This antibody reacts with human, mouse, rat. The CaMKII alpha / beta [p Thr287, p Thr286] Antibody (22B1) [DyLight 350] has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry / Immunofluorescence, Immunohistochemistry-Paraffin.
Catalog Number: (89282-378)

Supplier:  Genetex
Description:   Rabbit polyclonal antibody to TGF beta Receptor 2
Supplier:  ACROBIOSYSTEMS INC MS
Description:   IFN-alpha / beta R2 Protein, Fc Tag, Host: HEK293 Cells, Species Reactivity: Human, purity: >95%, Molecular Characterization: MW of 51.4 kDa, Synonym: IFNAR2,IFNARB,IFNABR,IFN-R-2,IFN-alpha/beta receptor 2, Storage: 4 deg C, Size: 1MG
Supplier:  Novus Biologicals
Description:   The beta Amyloid Antibody (MOAB-2) [DyLight 650] from Novus Biologicals is a mouse monoclonal antibody to beta Amyloid. This antibody reacts with human, mouse, rat. The beta Amyloid Antibody (MOAB-2) [DyLight 650] has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry / Immunofluorescence, Immunohistochemistry-Paraffin.

Supplier:  Sino Biological
Description:   This antibody was produced from a hybridoma resulting from the fusion of a mouse myeloma with B cells obtained from a mouse immunized with purified, recombinant Human IL-1 beta / IL1B (rh IL-1 beta / IL1B; Catalog#10139-H07E; NP_000567.1; Met1-Ser269). The IgG fraction of the cell culture supernatant was purified by Protein A affinity chromatography.
Catalog Number: (77207-266)

Supplier:  ANTIBODIES.COM LLC
Description:   Human Meprin beta ELISA kit is a 90 minutes sandwich Enzyme-Linked Immunosorbent Assay (sELISA) designed for the <i><i>in vitro</i></i> quantitative determination of human Meprin beta in serum, plasma, and other biological fluids.

Supplier:  ACROBIOSYSTEMS INC MS
Description:   ActiveMax* Recombinant TGF-Beta 1/TGFB1, Host: HEK293 cells, Species Reactivity: Human, Purity: >95%(SDS-PAGE), Molecular Characterization: Tag Free, MW of 12.8 KDa, Synonyms: TGFB1,CED,DPD1,LAP,TGFB1,TGF-beta, Storage: 4 deg C, Size: 50ug

Supplier:  Bioss
Description:   The chondroitin N-acetylgalactosaminyltransferase family includes Beta-1,4-GalNAc-T, Beta-1,4-GalNAc-T2, Beta-1,4-GalNAc-T3 and Beta-1,4-GalNAc-T4. The Beta-1,4-GalNAc-T protein consists of a short N-terminal residue, a transmembrane region and a long C-terminal residue, which includes a catalytic domain and localizes to the Golgi apparatus. Beta-1,4-GalNAc-T utilizes simple ganglioside GM3 as a substrate for more complex gangliosides GM2, GM1 and GD1a. Beta-1,4-GalNAc-T is expressed in normal brain tissues and in various malignant transformed cells, such as malignant melanoma, neuroblastoma and adult T cell leukemia. Mice lacking the Beta-1,4-GalNAc-T protein develop significant and progressive behavioral neuropathies, including deficits in reflexes, strength, coordination and balance. Beta-1,4-GalNAc-T is a potential molecular marker for detecting melanoma cells and monitoring tumor progression.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
2,945 - 2,960  of 33,993