Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

Gal[236Bn]beta(1-4)Glc[236Bn]-beta-MP


33,993  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"33993"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  TCI America
Description:   [for HPLC Labeling]
CAS Number: 14152-97-7
MDL Number: MFCD00043085
Molecular Formula: C15H19NO9S
Molecular Weight: 389.38
Purity/Analysis Method: >98.0% (HPLC,N)
Form: Crystal
Melting point (°C): 116
MSDS SDS
Catalog Number: (103008-238)

Supplier:  Anaspec Inc
Description:   This 37-amino acid peptide is the beta form of Calcitonin-gene-related peptide (β-CGRP), involved extensively in regulation of the cardiovascular and nervous systems. β-CGRP contains a disulphide bridge at the N-terminus, a C-terminal phenylalanine amide important for immune recognition, and an a-helix between residues 8 and 18.
Sequence:ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF-NH2 (Disulfide bridge:2-7)
MW:3793.4 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Supplier:  Boster Biological Technology
Description:   Sandwich High Sensitivity ELISA kit for Quantitative Detection of Human Klotho beta
Supplier:  Strem Chemicals Inc
Description:   Metal Beta-diketonates, Volatile Precursors for CVD
Supplier:  Bioss
Description:   Integrin alpha-V/beta-3 is a receptor for cytotactin, fibronectin, laminin, matrix metalloproteinase-2, osteopontin, osteomodulin, prothrombin, thrombospondin, vitronectin and von Willebrand factor. Integrin alpha-IIb/beta-3 is a receptor for fibronectin, fibrinogen, plasminogen, prothrombin, thrombospondin and vitronectin. Integrins alpha-IIb/beta-3 and alpha-V/beta-3 recognize the sequence R-G-D in a wide array of ligands. Integrin alpha-IIb/beta-3 recognizes the sequence H-H-L-G-G-G-A-K-Q-A-G-D-V in fibrinogen gamma chain. Following activation integrin alpha-IIb/beta-3 brings about platelet/platelet interaction through binding of soluble fibrinogen. This step leads to rapid platelet aggregation which physically plugs ruptured endothelial surface. Fibrinogen binding enhances SELP expression in activated platelets (By similarity). In case of HIV-1 infection, the interaction with extracellular viral Tat protein seems to enhance angiogenesis in Kaposi's sarcoma lesions.

Supplier:  Sino Biological
Description:   This antibody was obtained from a rabbit immunized with purified, recombinant Human beta-Catenin / CTNNB1 (rh beta-Catenin / CTNNB1; Catalog#11279-H20B; P35222-1; Met1-Leu781).

Supplier:  ANTIBODIES.COM LLC
Description:   Human Topoisomerase II beta/TOP2B ELISA kit is a 90 minutes sandwich Enzyme-Linked Immunosorbent Assay (sELISA) designed for the <i>in vitro</i> quantitative determination of human Topoisomerase II beta/TOP2B in serum, plasma, and other biological fluids.
Supplier:  Novus Biologicals
Description:   The beta Tubulin Antibody from Novus Biologicals is a rabbit polyclonal antibody to beta Tubulin. This antibody reacts with human, mouse, rat, porcine, bovine, chicken, chinese hamster, invertebrate, primate, xenopus, zebrafish. The beta Tubulin Antibody has been validated for the following applications: Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry / Immunofluorescence, Immunohistochemistry-Paraffin.
Supplier:  Enzo Life Sciences
Description:   DRB is a potent and specific inhibitor of casein kinase II (CKII, IC50~6 µM). It has been used to inhibit RNA polymerase II mediated-transcription which may be dependent on CKII and its interaction with ATF-1.

Supplier:  ANTIBODIES.COM LLC
Description:   Mouse Anti-beta Amyloid 42 Antibody ELISA kit is a indirect Enzyme-Linked Immunosorbent Assay designed for the <i>in vitro</i> quantitative determination of mouse Anti-beta Amyloid 42 Antibody in serum, plasma, tissue homogenates, and other biological fluids.
Supplier:  AFG BIOSCIENCE LLC
Description:   Human ATPase, Cu++ Transporting Beta PolyPeptide (ATP7b) ELISA Kit, AFG Bioscience
Supplier:  ANTIBODIES.COM LLC
Description:   Mouse monoclonal [VIPL2] antibody to Integrin beta 3 (FITC) for Flow Cytometry with samples derived from Human and Non-Human Primates.
Supplier:  R&D Systems
Description:   The Recombinant Mouse Activin C Protein from R&D Systems is derived from CHO. The Recombinant Mouse Activin C Protein has been validated for the following applications: Bioactivity.

Supplier:  ANTIBODIES.COM LLC
Description:   Goat polyclonal antibody to Proteasome 20S beta 7 for ELISA and WB with samples derived from Human and Mouse.
Supplier:  AMBEED, INC
Description:   Arbutin 98%
Supplier:  Promega Corporation
Description:   Recombinant full-length human PKCbeta I was expressed by baculovirus in Sf9 insect cells using an N-terminal GST tag. PKCβI is a member of the PKC family (phospholipid-dependent serine/threonine kinase) and is highly related to PKCβ II.
MSDS SDS
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
3,473 - 3,488  of 33,993