Text Search >
Gal[236Bn]beta(1-4)Glc[236Bn]-beta-MP
Print…
You Searched For:
33,994 results were found
Gal[236Bn]beta(1-4)Glc[236Bn]-beta-MP
Catalog Number:
(10362-512)
Supplier:
Bioss
Description:
IKK Alpha/IKK beta is a member of the IKK complex which is composed of IKK alpha, IKK beta, IKK gamma and IKAP. Phosphorylation of I-Kappa-B on a serine residue by the IKK complex frees NF-kB from I-Kappa-B and marks it for degradation via ubiquination. IKK beta has been shown to activate NF-kB and phosphorylate IKB alpha and beta. Phosphorylation of 2 sites at the activation loop of IKK beta is essential for activation of IKK by TNF and IL1. Once activated, IKK beta autophosphorylates which in turn decreases IKK activity and prevents prolonged activation of the inflammatory response. Additionally, IKK beta activity can also be regulated by MEKK1.
Catalog Number:
(103269-036)
Supplier:
Novus Biologicals
Description:
The Choline Kinase beta Antibody from Novus Biologicals is a rabbit polyclonal antibody to Choline Kinase beta. This antibody reacts with human. The Choline Kinase beta Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry / Immunofluorescence, Immunohistochemistry-Paraffin.
Catalog Number:
(76172-150)
Supplier:
Boster Biological Technology
Description:
Sandwich High Sensitivity ELISA kit for Quantitative Detection of activated monkey primate TGF beta 1
Catalog Number:
(103329-658)
Supplier:
Novus Biologicals
Description:
The Inhibin beta B Antibody from Novus Biologicals is a rabbit polyclonal antibody to Inhibin beta B. This antibody reacts with human, mouse. The Inhibin beta B Antibody has been validated for the following applications: Western Blot, Proximity Ligation Assay.
Catalog Number:
(103404-754)
Supplier:
Novus Biologicals
Description:
The beta Casein Antibody (F20.14) [DyLight 650] from Novus Biologicals is a mouse monoclonal antibody to beta Casein. This antibody reacts with human. The beta Casein Antibody (F20.14) [DyLight 650] has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry, Immunohistochemistry-Frozen.
Supplier:
Biotium
Description:
This MAb recognizes TGF beta 1, 2 and 3. Three TGF betas have been identified in mammals. TGF beta 1, TGF beta 2 and TGF beta 3 are each synthesized as precursor proteins that are very similar in that each is cleaved to yield a 112 amino acid polypeptide that remains associated with the latent portion of the molecules. Biologically active TGF beta requires dimerization of the monomers (usually homodimers) and release of the latent peptide portion. Overall, the mature region of the TGF beta 3 protein has approximately 80% identity to the mature region of both TGF beta 1 and TGF beta 2. However, the NH2 terminals or precursor regions of their molecules share only 27% sequence identity. TGF betas inhibit the growth of epithelial cells and stimulate the growth of mesenchymal cells.
CF® dyes are Biotium's next-generation fluorescent dyes. CF®488A is a green fluorescent dye (Ex/Em 490/515 nm) with excellent brightness and photostability. The dye is minimally charged for less non-specific binding. CF®488A also is compatible with super-resolution imaging by TIRF.
Catalog Number:
(103260-736)
Supplier:
Novus Biologicals
Description:
The epithelial Sodium Channel beta Antibody from Novus Biologicals is a rabbit polyclonal antibody to epithelial Sodium Channel beta. This antibody reacts with human. The epithelial Sodium Channel beta Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Catalog Number:
(103402-776)
Supplier:
Novus Biologicals
Description:
The beta II Tubulin B Antibody (5B2) [FITC] from Novus Biologicals is a mouse monoclonal antibody to beta II Tubulin B. This antibody reacts with human, mouse. The beta II Tubulin B Antibody (5B2) [FITC] has been validated for the following applications: ELISA, Immunocytochemistry / Immunofluorescence.
Catalog Number:
(75934-604)
Supplier:
Rockland Immunochemical
Description:
HSP90 beta control protein-HIS Epitope
Catalog Number:
(103006-992)
Supplier:
Anaspec Inc
Description:
Beta-amyloid is the main component of amyloid deposits in the AD brain. Beta-amyloid peptides have a heterogeneous C-terminus with the majority composed ofAβ1-40, while a minor product is Aβ 1-42. Additional minor Aβ peptides are also normally produced, such as Beta-amyloid 1-34, 1-37, 1-38 and 1-39, and few reports have quantified the levels of these peptides in the brain.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL Molecular Weight: 3787.2 Da % Peak Area by HPLC: ≥95 Peptide Content: ≥ 60% Storage condition: -20°C
Catalog Number:
(76744-796)
Supplier:
ANTIBODIES.COM LLC
Description:
Porcine Interferon beta ELISA kit is a sandwich Enzyme-Linked Immunosorbent Assay (sELISA) designed for the <i>in vitro</i> quantitative determination of porcine Interferon beta in serum, plasma, tissue homogenates, and other biological fluids.
Catalog Number:
(TCT1094-001G)
Supplier:
TCI America
Description:
CAS Number: 55216-11-0
MDL Number: MFCD00010728
Molecular Formula: C63H112O35
Molecular Weight: 1429.55
Purity/Analysis Method: <gt/>98.0% (HPLC)
Form: Crystal
Color: White
Melting point (°C): 159
Specific rotation [a]20/D: 160 deg (C=1, CHCl3)
Supplier:
BeanTown Chemical
Description:
CAS: 2492-87-7; EC No: 219-661-3; MDL No: MFCD00006593
Crystalline; Molecular Formula: C12H15NO8; MW: 301.25
Catalog Number:
(103404-798)
Supplier:
Novus Biologicals
Description:
The beta Tubulin Antibody (1B12) [DyLight 405] from Novus Biologicals is a mouse monoclonal antibody to beta Tubulin. This antibody reacts with human, mouse, rat, porcine, bovine. The beta Tubulin Antibody (1B12) [DyLight 405] has been validated for the following applications: Western Blot, Immunocytochemistry / Immunofluorescence.
Supplier:
TCI America
Description:
CAS Number: 84635-54-1
MDL Number: MFCD00080803
Molecular Formula: C13H20O7S
Molecular Weight: 320.36
Purity/Analysis Method: <gt/>98.0% (HPLC)
Form: Crystal
Melting point (°C): 148
Specific rotation [a]20/D: 1.5 deg (C=1, CHCl3)
Storage Temperature: <lt/>0°C
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
 is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||
List View
