Gal[236Bn]beta(1-4)Glc[236Bn]-beta-MP
Catalog Number:
(103404-754)
Supplier:
Novus Biologicals
Description:
The beta Casein Antibody (F20.14) [DyLight 650] from Novus Biologicals is a mouse monoclonal antibody to beta Casein. This antibody reacts with human. The beta Casein Antibody (F20.14) [DyLight 650] has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry, Immunohistochemistry-Frozen.
Catalog Number:
(103260-736)
Supplier:
Novus Biologicals
Description:
The epithelial Sodium Channel beta Antibody from Novus Biologicals is a rabbit polyclonal antibody to epithelial Sodium Channel beta. This antibody reacts with human. The epithelial Sodium Channel beta Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Catalog Number:
(76744-796)
Supplier:
ANTIBODIES.COM LLC
Description:
Porcine Interferon beta ELISA kit is a sandwich Enzyme-Linked Immunosorbent Assay (sELISA) designed for the <i>in vitro</i> quantitative determination of porcine Interferon beta in serum, plasma, tissue homogenates, and other biological fluids.
Supplier:
Biotium
Description:
This MAb recognizes TGF beta 1, 2 and 3. Three TGF betas have been identified in mammals. TGF beta 1, TGF beta 2 and TGF beta 3 are each synthesized as precursor proteins that are very similar in that each is cleaved to yield a 112 amino acid polypeptide that remains associated with the latent portion of the molecules. Biologically active TGF beta requires dimerization of the monomers (usually homodimers) and release of the latent peptide portion. Overall, the mature region of the TGF beta 3 protein has approximately 80% identity to the mature region of both TGF beta 1 and TGF beta 2. However, the NH2 terminals or precursor regions of their molecules share only 27% sequence identity. TGF betas inhibit the growth of epithelial cells and stimulate the growth of mesenchymal cells.
CF® dyes are Biotium's next-generation fluorescent dyes. CF®488A is a green fluorescent dye (Ex/Em 490/515 nm) with excellent brightness and photostability. The dye is minimally charged for less non-specific binding. CF®488A also is compatible with super-resolution imaging by TIRF.
Catalog Number:
(TCT1094-001G)
Supplier:
TCI America
Description:
CAS Number: 55216-11-0
MDL Number: MFCD00010728
Molecular Formula: C63H112O35
Molecular Weight: 1429.55
Purity/Analysis Method: <gt/>98.0% (HPLC)
Form: Crystal
Color: White
Melting point (°C): 159
Specific rotation [a]20/D: 160 deg (C=1, CHCl3)
Supplier:
BeanTown Chemical
Description:
CAS: 2492-87-7; EC No: 219-661-3; MDL No: MFCD00006593
Crystalline; Molecular Formula: C12H15NO8; MW: 301.25
Catalog Number:
(103404-798)
Supplier:
Novus Biologicals
Description:
The beta Tubulin Antibody (1B12) [DyLight 405] from Novus Biologicals is a mouse monoclonal antibody to beta Tubulin. This antibody reacts with human, mouse, rat, porcine, bovine. The beta Tubulin Antibody (1B12) [DyLight 405] has been validated for the following applications: Western Blot, Immunocytochemistry / Immunofluorescence.
Supplier:
TCI America
Description:
CAS Number: 84635-54-1
MDL Number: MFCD00080803
Molecular Formula: C13H20O7S
Molecular Weight: 320.36
Purity/Analysis Method: <gt/>98.0% (HPLC)
Form: Crystal
Melting point (°C): 148
Specific rotation [a]20/D: 1.5 deg (C=1, CHCl3)
Storage Temperature: <lt/>0°C
Catalog Number:
(103006-992)
Supplier:
Anaspec Inc
Description:
Beta-amyloid is the main component of amyloid deposits in the AD brain. Beta-amyloid peptides have a heterogeneous C-terminus with the majority composed ofAβ1-40, while a minor product is Aβ 1-42. Additional minor Aβ peptides are also normally produced, such as Beta-amyloid 1-34, 1-37, 1-38 and 1-39, and few reports have quantified the levels of these peptides in the brain.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL Molecular Weight: 3787.2 Da % Peak Area by HPLC: ≥95 Peptide Content: ≥ 60% Storage condition: -20°C
Catalog Number:
(220024-479)
Supplier:
R&D Systems
Description:
The Recombinant Human NRG1-beta 1/HRG1-beta 1 EGF Domain from R&D Systems is derived from E. coli. The Recombinant Human NRG1-beta 1/HRG1-beta 1 EGF Domain has been validated for the following applications: Bioactivity.
Catalog Number:
(103404-726)
Supplier:
Novus Biologicals
Description:
The beta 2-Microglobulin Antibody (B2M / 961) [HRP] from Novus Biologicals is a mouse monoclonal antibody to beta 2-Microglobulin. This antibody reacts with human, primate. The beta 2-Microglobulin Antibody (B2M / 961) [HRP] has been validated for the following applications: Immunohistochemistry-Paraffin.
Catalog Number:
(76172-314)
Supplier:
Boster Biological Technology
Description:
Sandwich High Sensitivity ELISA kit for Quantitative Detection of activated Bovine TGF-beta 3
Catalog Number:
(103275-926)
Supplier:
Novus Biologicals
Description:
The Integrin beta 2 / CD18 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Integrin beta 2 / CD18. This antibody reacts with human. The Integrin beta 2 / CD18 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry / Immunofluorescence, Immunohistochemistry-Paraffin.
Catalog Number:
(103268-752)
Supplier:
Novus Biologicals
Description:
The 17 beta-HSD1 / HSD17B1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to 17 beta-HSD1 / HSD17B1. This antibody reacts with human. The 17 beta-HSD1 / HSD17B1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry / Immunofluorescence, Immunohistochemistry-Paraffin.
Catalog Number:
(76108-068)
Supplier:
Bioss
Description:
Plays an important role in the degradation of dermatan and keratan sulfates.
Catalog Number:
(10814-478)
Supplier:
Thermo Scientific Chemicals
Description:
N-Dodecyl beta-D-glucopyranoside, CAS Number: 59122-55-3, Molecular Formula: C18H36O6, Color: White, Form: Powder, Synonyms: Dodecylglucoside, Size: 1G
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
![]()
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
![]()
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||