Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

2-Methyl-2H-indazole-3-carboxylic acid


2,155  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"2155"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  Bachem Americas
Description:   For the long-acting GLP-1 analog liraglutide see H-6724.
Supplier:  AFG BIOSCIENCE LLC
Description:   Human PAM (Peptidylglycine Alpha Amidating Monooxygenase) ELISA Kit
Supplier:  Bachem Americas
Description:   PAR peptides (TRAP peptides and thrombin receptor-like peptides) activate the proteinase-activated receptors PAR-1 to PAR-4.
Supplier:  Thermo Scientific Chemicals
Description:   99%. 50g.
MSDS SDS
Supplier:  Bachem Americas
Description:   1mg CAS: 112955-31-4 C180H288N58O47 FW: 4016.63 . Synonym: Hypercalcemia of Malignancy Factor (1-34) amide (human, mouse, rat), pTHrP (1-34) amide (human, mouse, rat)
Supplier:  Novus Biologicals
Description:   AMID Overexpression Lysate (Adult Normal)
Catalog Number: (103008-696)

Supplier:  Anaspec Inc
Description:   GLP-1 (9-36) is the result of the rapid degradation of GLP-1 (7-36)amide, by the enzyme dipeptidyl peptidase IV (DPP-4), which is widely expressed in a number of sites, including the endothelial cells of small gut arterioles. GLP-1 (9-36) accounts for the majority of GLP-1 that reaches the system circulation. Whereas GLP-1 (7-36) amide stimulates glucose-dependent insulin secretion and inhibits glucagon secretion, GLP-1(9-36)amide administration had no effect on glucose clearance or insulin secretion in humans. GLP-1(9-36)amide however was shown to exert cardioprotective actions in rodent hearts.
Sequence: EGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
MW: 3089.5 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Supplier:  TLC PHARMACEUTICAL STANDARD LTD
Description:   Pharmaceutical Standards, Ketoprofen Tromethamine Amide
Supplier:  Matrix Scientific
MSDS SDS
Supplier:  TLC PHARMACEUTICAL STANDARD LTD
Description:   Pharmaceutical Standards, Voltindole (Aceclofenac EP Impurity I, Diclofenac EP Impurity A, Diclofenac Amide)
Supplier:  Thermo Scientific Chemicals
Description:   White to off-white
MSDS SDS
Catalog Number: (H-3715.0500BA)

Supplier:  Bachem Americas
Description:   For sermorelin see H-3705.
Supplier:  Thermo Scientific Chemicals
Description:   Glucagon-Like Peptide-1 (7-36) amide, human
Supplier:  Novus Biologicals
Description:   The AMID Antibody from Novus Biologicals is a rabbit polyclonal antibody to AMID. This antibody reacts with human. The AMID Antibody has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen.
Catalog Number: (AAJ60573-A1)

Supplier:  Thermo Scientific Chemicals
Description:   Crystalline powder
MSDS SDS
Supplier:  AMBEED, INC
Description:   Lithium bis(fluorosulfonyl)amide, Purity: 98%, CAS Number: 171611-11-3, Appearance: White to yellow powder or crystals, Storage: Inert atmosphere, 2-8 C, Size: 5g
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
145 - 160  of 2,155
  1  2  3  4  5  6  7  8  9  10  11  12  13  14  15  Next