FLUO+3\/AM
Catalog Number:
(RL009-0209)
Supplier:
Rockland Immunochemical
Description:
Produced through a multi-stage process that includes delipidation, salt fractionation, ion-exchange chromatography, gel filtration, and affinity chromatography. No contaminating proteins are observed when assayed at a protein concentration of 20mg/mL against anti-whole serum or anti-fragment specific antisera. All immunoglobulin fragments are prepared from highly purified, whole molecules subject to enzymatic digestion.
Catalog Number:
(RL009-0309)
Supplier:
Rockland Immunochemical
Description:
Produced through a multi-stage process that includes delipidation, salt fractionation, ion-exchange chromatography, gel filtration, and affinity chromatography. No contaminating proteins are observed when assayed at a protein concentration of 20mg/mL against anti-whole serum or anti-fragment specific antisera. All immunoglobulin fragments are prepared from highly purified, whole molecules subject to enzymatic digestion.
Catalog Number:
(103007-216)
Supplier:
Anaspec Inc
Description:
This is amino acids 1 to 42 fragment of the beta-amyloid peptide, with lysine substituted for glutamic acid at position 22 found in Italian families with Alzheimer's disease. The Italian mutation of beta -amyloid 1 to 42 (E22K) aggregates more rapidly and with more potent neurotoxicity than wild-type beta-amyloid (1-42). The formation of a salt bridge between Lys22 and Asp23 in the minor conformer might be a reason why E22K is more pathogenic than wild-type beta-amyloid (1-42).
Sequence: DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVVIA MW: 4513.1 Da % Peak Area by HPLC: ≥95 Peptide Content: ≥ 60% Storage condition: -20°C
Catalog Number:
(RL001-0305)
Supplier:
Rockland Immunochemical
Description:
Produced through a multi-stage process that includes delipidation, salt fractionation, ion-exchange chromatography, gel filtration, and affinity chromatography. No contaminating proteins are observed when assayed at a protein concentration of 20mg/mL against anti-whole serum or anti-fragment specific antisera. All immunoglobulin fragments are prepared from highly purified, whole molecules subject to enzymatic digestion.
Catalog Number:
(RL005-0304)
Supplier:
Rockland Immunochemical
Description:
Produced through a multi-stage process that includes delipidation, salt fractionation, ion-exchange chromatography, gel filtration, and affinity chromatography. No contaminating proteins are observed when assayed at a protein concentration of 20mg/mL against anti-whole serum or anti-fragment specific antisera. All immunoglobulin fragments are prepared from highly purified, whole molecules subject to enzymatic digestion.
Catalog Number:
(100504-920)
Supplier:
Electron Microscopy Sciences
Description:
Brilliant Cresyl Blue, Certified C.I. DcV-5 is also known as Brilliant Blue C and Cresyl Blue 2RN.
![]()
Catalog Number:
(75790-940)
Supplier:
Prosci
Description:
Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4(PIN4) is a peptidyl-prolyl cis/trans isomerase (PPIase) which interacts with NIMA and is vital for cell cycle regulation. PIN4 has 2 different isoforms: PAR14 and PAR17. Furthermore, PIN4 protein binds to double-stranded DNA under physiological salt conditions. PIN4 is involved as a ribosomal RNA processing factor in ribosome biogenesis. The PAR14 binds to tightly bent AT-rich stretches of double-stranded DNA, but PAR17 binds to double-stranded DNA.
Catalog Number:
(RL001-0107)
Supplier:
Rockland Immunochemical
Description:
Produced through a multi-stage process that includes delipidation, salt fractionation, ion-exchange chromatography, gel filtration, and affinity chromatography. No contaminating proteins are observed when assayed at a protein concentration of 20mg/mL against anti-whole serum or anti-fragment specific antisera. All immunoglobulin fragments are prepared from highly purified, whole molecules subject to enzymatic digestion.
Catalog Number:
(76002-308)
Supplier:
Enzo Life Sciences
Description:
TLR9 ligand.
Catalog Number:
(89333-560)
Supplier:
Genetex
Description:
Rabbit Polyclonal antibody to Sumo
Catalog Number:
(RL012-0634)
Supplier:
Rockland Immunochemical
Description:
Produced through a multi-stage process that includes delipidation, salt fractionation, ion-exchange chromatography, gel filtration, and affinity chromatography. No contaminating proteins are observed when assayed at a protein concentration of 20mg/mL against anti-whole serum or anti-fragment specific antisera. All immunoglobulin fragments are prepared from highly purified, whole molecules subject to enzymatic digestion.
![]() ![]()
Catalog Number:
(BJ25011-1KG)
Supplier:
Honeywell Research Chemicals
Description:
Calcium acetate, Purity: 99.0-100.5%, Grade: puriss, CAS Number: 114460-21-8, Molecular formula: (CH3COO)2Ca.xH2O, Molar mass: 158.17 g/mol, PH: 7-9.0 (20 deg C, 10%)meets analytical specification of FCC, E263, Container Type: Poly bottle, Size: 1KG
Catalog Number:
(RL004-0107)
Supplier:
Rockland Immunochemical
Description:
Produced through a multi-stage process that includes delipidation, salt fractionation, ion-exchange chromatography, gel filtration, and affinity chromatography. No contaminating proteins are observed when assayed at a protein concentration of 20mg/mL against anti-whole serum or anti-fragment specific antisera. All immunoglobulin fragments are prepared from highly purified, whole molecules subject to enzymatic digestion.
Catalog Number:
(76998-342)
Supplier:
AMBEED, INC
Description:
Dicyclohexylamine (2S,3R)-2-(((benzyloxy)carbonyl)amino)-3-(tert-butoxy)butanoate, Purity: 97%, CAS number: 16966-07-7, Appearance: White to off-white powder or crystals, Storage: Inert atmosphere, 2-8C, Size: 100G
Supplier:
AMBEED, INC
Description:
Magnesium acetate ≥98%
Supplier:
Spectrum Chemicals
Description:
Calcium Disodium EDTA, FCC is used as a flavor and color preservative. Spectrum Chemical offers over 300 Food grade chemical ingredients packaged in laboratory size bottles to production drum quantities and are manufactured, packaged and stored under current Good Manufacturing Practices (cGMP) per 21CFR part 211 in FDA registered and inspected facilities.
![]()
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
![]()
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
![]()
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||