Text Search >
Hafnium+(IV)+acetylacetonate
Print…
You Searched For:
3,696 results were found
Hafnium+(IV)+acetylacetonate
Catalog Number:
(10783-820)
Supplier:
CHI Scientific
Description:
Kit PrimaCell* Mouse Ureter OptiTDS*: Tissue Dissociation System, A mixture of collagenase I, collagenase III, collagenase IV, collagenase, and trypsin
Supplier:
HCL Label
Description:
Laser labels are made of a durable adhesive vinyl.
Catalog Number:
(10785-364)
Supplier:
CHI Scientific
Description:
Kit, Human Glomerular OptiTDS*, PrimaCell* Tissue Dissociation System, A mixture of collagenase I, collagenase III, collagenase III, and collagenase IV, Stability: package should be stored at -20 degree Celcius, and effective up to 4 months
Catalog Number:
(76545-626)
Supplier:
Labconco
Description:
Accessories for Purifier® Vertical Clean Benches, 6', Labconco®
Catalog Number:
(10785-068)
Supplier:
CHI Scientific
Description:
Kit, Primacell* 2 Human Lung OptiTDS*2: Tissue Dissociation System, A mixture of collagenase I, collagenase III, collagenase III, and collagenase IV, Stability/Storage: Stable at the room temperature, stored at -20 deg C
Catalog Number:
(89158-858)
Supplier:
Enzo Life Sciences
Description:
An intercalating transcription inhibitor and antineoplastic antibiotic
Catalog Number:
(10785-268)
Supplier:
CHI Scientific
Description:
Kit, Human Umbilical Cord OptiTDS* 5, PrimaCell* Tissue Dissociation System, A mixture of collagenase I, collagenase III, collagenase IV, and trypsin, Stability: package should be stored at -20 degree Celcius, and effective up to 4 months
Catalog Number:
(76116-498)
Supplier:
Bioss
Description:
Calpains are a family of cytosolic calcium activated cysteine proteases involved in a variety of cellular processes including apoptosis, cell division, modulation of integrin and cytoskeletal interactions, and synaptic plasticity. Calpain 12 was first described in the mouse, most strongly in the skin, and maps to mouse chromosome 7. Isoforms differ in the carboxyterminal ends, ending with aberrant domain III and lacking domain IV. Domains in the large subunit include the amino terminal domain I, the proteinase domain II, domain III, and the EF hand domain IV, making Calpain 12 most similar to calpains 1 and 2.
Supplier:
BeanTown Chemical
Description:
CAS: 12070-06-3; EC No: 235-118-3; MDL No: MFCD00011255
UN No: UN3178; Haz Class: 4.1; Packing Group: III
-325 Mesh Powder; Linear Formula: TaC; MW: 192.96
Melting Point: 3880°
Supplier:
Electron Microscopy Sciences
Description:
This is a direct replacement for Kodak Polycontrast IV RC B&W Papers. MULTIGRADE RC Warmtone Paper has the standard weight of (190g/m<sup>2</sup>) with a resin coated base. It is equally suitable for printing conventional black and white and XP2 SUPER negatives.
Catalog Number:
(103006-440)
Supplier:
Anaspec Inc
Description:
This peptide is from amino acid 3-42 of the full length 42-amino acid long GIP (Glucose-dependent Insulinotropic Polypeptide or also known as Gastric Inhibitory Polypeptide). The in-vivo degradation of the first two N-terminal amino acids (Tyr-Ala) by the enzyme dipeptidyl peptidase IV (DPP IV) results in making GIP (3-42) a potent antagonist as opposed to the agonist full length GIP on the GIP receptor.
Sequence: EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ MW: 4759.4 Da % Peak area by HPLC: 95 Storage condition: -20° C
Catalog Number:
(89358-786)
Supplier:
Genetex
Description:
Polymorphonuclear leukocyte serine protease that degrades elastin, fibronectin, laminin, vitronectin, and collagen types I, III, and IV (in vitro) and causes emphysema when administered by tracheal insufflation to hamsters.
Supplier:
AMBEED, INC
Description:
5-(4-Fluorophenyl)-2-ureidothiophene-3-carboxamide, Purity: 98+%, CAS Number: 507475-17-4, Appearance: Form: solid, Storage: Keep in dark place, Sealed in dry, 2-8C, Size: 50MG
Catalog Number:
(10326-244)
Supplier:
Bioss
Description:
Efficiently joins single-strand breaks in a double-stranded polydeoxynucleotide in an ATP-dependent reaction. Involved in DNA non-homologous end joining (NHEJ) required for double-strand break repair and V(D)J recombination. The LIG4-XRCC4 complex is responsible for the NHEJ ligation step, and XRCC4 enhances the joining activity of LIG4. Binding of the LIG4-XRCC4 complex to DNA ends is dependent on the assembly of the DNA-dependent protein kinase complex DNA-PK to these DNA ends.
Catalog Number:
(101914-672)
Supplier:
Matrix Scientific
Description:
Matrix Scientific Part Number: 058370-500MG , MDL Number: MFCD00038130
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
 is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||
List View
