Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

1-Amino-2-methylpropan-2-ol


17,106  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"17106"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  Bioss
Description:   L-glutamate is the major excitatory neurotransmitter in the central nervous system and activates both ionotropic and metabotropic glutamate receptors. Glutamatergic neurotransmission is involved in most aspects of normal brain function and can be perturbed in many neuropathologic conditions. The metabotropic glutamate receptors are a family of G protein-coupled receptors, that have been divided into 3 groups on the basis of sequence homology, putative signal transduction mechanisms, and pharmacologic properties. Group I includes GRM1 and GRM5 and these receptors have been shown to activate phospholipase C. Group II includes GRM2 and GRM3 while Group III includes GRM4, GRM6, GRM7 and GRM8. Group II and III receptors are linked to the inhibition of the cyclic AMP cascade but differ in their agonist selectivities. The canonical alpha isoform of the metabotropic glutamate receptor 1 gene is a disulfide-linked homodimer whose activity is mediated by a G-protein-coupled phosphatidylinositol-calcium second messenger system. Alternative splicing results in multiple transcript variants encoding distinct isoforms; some of which may have distinct functions. [provided by RefSeq].
Catalog Number: (10082-228)

Supplier:  Proteintech
Description:   SPHK(Sphingosine kinase 1) is also named as SPHK, SPK.It catalyzes the phosphorylation of sphingosine to form sphingosine 1-phosphate (SPP), a lipid mediator with both intra- and extracellular functions and is precariously perched at the balance point between progrowth and pro-death signalling in the cell.Endogenous SPHK1 purified from placenta has identical enzymatic characteristics, suggesting posttranslational modification does not effect functional properties.It has 2 isoforms produced by alternative splicing and can form the oligomeric structure.
Catalog Number: (75791-842)

Supplier:  Prosci
Description:   Discoidin domain receptor-2 (DDR2) is a cell surface tyrosine kinase receptor that can be activated by soluble collagen and has been implicated in diverse physiological functions including organism growth and wound repair. DDR2 binds to and is activated by collagen I, II, III, V, and X, with the notable exception of basement membrane collagen IV. DDR2 is expressed in connective tissues arising from embryonic mesoderm. DDR2 regulates cell proliferation, cell adhesion, migration, and extracellular matrix remodeling.

Supplier:  Bioss
Description:   Catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate in the presence of divalent cations, acting as a rate-limiting enzyme in gluconeogenesis. Plays a role in regulating glucose sensing and insulin secretion of pancreatic beta-cells. Appears to modulate glycerol gluconeogenesis in liver. Important regulator of appetite and adiposity; increased expression of the protein in liver after nutrient excess increases circulating satiety hormones and reduces appetite-stimulating neuropeptides and thus seems to provide a feedback mechanism to limit weight gain.

Supplier:  Bioss
Description:   Catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate in the presence of divalent cations, acting as a rate-limiting enzyme in gluconeogenesis. Plays a role in regulating glucose sensing and insulin secretion of pancreatic beta-cells. Appears to modulate glycerol gluconeogenesis in liver. Important regulator of appetite and adiposity; increased expression of the protein in liver after nutrient excess increases circulating satiety hormones and reduces appetite-stimulating neuropeptides and thus seems to provide a feedback mechanism to limit weight gain.
Supplier:  Prosci
Description:   The 2.4G2 monoclonal antibody specifically reacts with an epitope on the extracellular domain of the mouse CD16 (Fc gamma III) and CD 32 (Fc gamma II). CD16 and CD32 are low affinity receptors for the IgG Fc domain and are expressed by B lymphocytes, NK cells, kupffer cells, mast cells, monocytes, macrophages, granulocytes, immature thymocytes, neutrophils, and some activated mature T cells.The 2.4G2 antibody blocks the binding of immunoglobulins to CD16 and CD32, and possibly to Fc gamma I receptor.

Supplier:  Prosci
Description:   The 2.4G2 monoclonal antibody specifically reacts with an epitope on the extracellular domain of the mouse CD16 (Fc gamma III) and CD 32 (Fc gamma II). CD16 and CD32 are low affinity receptors for the IgG Fc domain and are expressed by B lymphocytes, NK cells, kupffer cells, mast cells, monocytes, macrophages, granulocytes, immature thymocytes, neutrophils, and some activated mature T cells.The 2.4G2 antibody blocks the binding of immunoglobulins to CD16 and CD32, and possibly to Fc gamma I receptor.
Supplier:  Adipogen
Description:   A slow, tight binding and highly selective inhibitor of iNOS (inducible nitric oxide synthase/NOS II) (Kd <lt/> 7 nM). Weak and reversible inhibition of nNOS (neuronal nitric oxide synthase/NOS I) (Ki <lt/> 2) and eNOS (endothelial nitric oxide synthase/NOS III) (Ki <lt/> 50 µM). Inhibits tumor growth. Increases vasoconstriction to noradrenaline. Improves contractile function. Improves stroke outcome and decreases glutamate release. Anti-inflammatory. Review.
Small Business Enterprise
Catalog Number: (10391-050)

Supplier:  Bioss
Description:   Catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate in the presence of divalent cations, acting as a rate-limiting enzyme in gluconeogenesis. Plays a role in regulating glucose sensing and insulin secretion of pancreatic beta-cells. Appears to modulate glycerol gluconeogenesis in liver. Important regulator of appetite and adiposity; increased expression of the protein in liver after nutrient excess increases circulating satiety hormones and reduces appetite-stimulating neuropeptides and thus seems to provide a feedback mechanism to limit weight gain.

Supplier:  Prosci
Description:   The 2.4G2 monoclonal antibody specifically reacts with an epitope on the extracellular domain of the mouse CD16 (Fc gamma III) and CD 32 (Fc gamma II). CD16 and CD32 are low affinity receptors for the IgG Fc domain and are expressed by B lymphocytes, NK cells, kupffer cells, mast cells, monocytes, macrophages, granulocytes, immature thymocytes, neutrophils, and some activated mature T cells.The 2.4G2 antibody blocks the binding of immunoglobulins to CD16 and CD32, and possibly to Fc gamma I receptor.
Supplier:  Prosci
Description:   The 2.4G2 monoclonal antibody specifically reacts with an epitope on the extracellular domain of the mouse CD16 (Fc gamma III) and CD 32 (Fc gamma II). CD16 and CD32 are low affinity receptors for the IgG Fc domain and are expressed by B lymphocytes, NK cells, kupffer cells, mast cells, monocytes, macrophages, granulocytes, immature thymocytes, neutrophils, and some activated mature T cells.The 2.4G2 antibody blocks the binding of immunoglobulins to CD16 and CD32, and possibly to Fc gamma I receptor.

Supplier:  Prosci
Description:   The 2.4G2 monoclonal antibody specifically reacts with an epitope on the extracellular domain of the mouse CD16 (Fc gamma III) and CD 32 (Fc gamma II). CD16 and CD32 are low affinity receptors for the IgG Fc domain and are expressed by B lymphocytes, NK cells, kupffer cells, mast cells, monocytes, macrophages, granulocytes, immature thymocytes, neutrophils, and some activated mature T cells.The 2.4G2 antibody blocks the binding of immunoglobulins to CD16 and CD32, and possibly to Fc gamma I receptor.
Supplier:  Prosci
Description:   The 2.4G2 monoclonal antibody specifically reacts with an epitope on the extracellular domain of the mouse CD16 (Fc gamma III) and CD 32 (Fc gamma II). CD16 and CD32 are low affinity receptors for the IgG Fc domain and are expressed by B lymphocytes, NK cells, kupffer cells, mast cells, monocytes, macrophages, granulocytes, immature thymocytes, neutrophils, and some activated mature T cells.The 2.4G2 antibody blocks the binding of immunoglobulins to CD16 and CD32, and possibly to Fc gamma I receptor.

Supplier:  Prosci
Description:   Autotaxin also known as ectonucleotide pyrophosphatase / phosphodiesterase family member 2 (E-NPP 2 or ENPP2), Extracellular lysophospholipase D (LysoPLD), Autotaxin (ATX or ATX-X), which belongs to the nucleotide pyrophosphatase / phosphodiesterase family. ENPP2 contains two SMB (somatomedin-B) domains. ENPP2 hydrolyzes lysophospholipids to produce lysophosphatidic acid (LPA) in extracellular fluids. ENPP2 can act on sphingosylphosphphorylcholine producing sphingosine-1-phosphate, a modulator of cell motility. ENPP2 stimulates migration of melanoma cells, probably via a pertussis toxin-sensitive G protein.

Supplier:  Anaspec Inc
Description:   Parathyroid hormone (PTH) regulates the metabolism of calcium and phosphate. PTH and PTH-related polypeptide (PTHrP) play important roles in calcium homeostasis of bone, kidney, breast, and placenta; they signal via the PTH/PTHrP and PTH2 receptors. PTH(1–34) administration suppresses cardiovascular calcification and down-regulates aortic osteogenic programs driven by diabetes and dyslipidemia.
Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFK(Biotin)
MW: 4472.2 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Supplier:  Bioss
Description:   Catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate in the presence of divalent cations, acting as a rate-limiting enzyme in gluconeogenesis. Plays a role in regulating glucose sensing and insulin secretion of pancreatic beta-cells. Appears to modulate glycerol gluconeogenesis in liver. Important regulator of appetite and adiposity; increased expression of the protein in liver after nutrient excess increases circulating satiety hormones and reduces appetite-stimulating neuropeptides and thus seems to provide a feedback mechanism to limit weight gain.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
129 - 144  of 17,106