Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

1-(3-Fluorophenyl)cyclopentanecarboxylic+acid


1  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"1"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Catalog Number: (76288-432)

Supplier:  Enzo Life Sciences
Description:   Produced in <i>E. coli</i>. Contains 125 amino acids.
Catalog Number: (82022-860)

Supplier:  G-Biosciences
Description:   G-Biosciences' HPG (p-hydroxyphenylglyoxal) specifically reacts with arginine residues under mild conditions (pH 7 to 9, 25°C) to yield spectrophotometrically measurable signal for amino acid detection.
Supplier:  AMBEED, INC
Description:   N-Benzyloxycarbonyl-L-glutamic acid-1-tert-butyl ester dicyclohexylammonium salt 97%
Supplier:  Thermo Scientific Chemicals
Description:   Nalpha-Benzyloxycarbonyl-L-ornithine, 98%
MSDS SDS
Catalog Number: (75790-154)

Supplier:  Prosci
Description:   Calumenin is a secreted calcium-binding protein that belongs to the CREC family. Calumenin contains six EF-hand domains and is expressed at high levels in the heart, placenta and skeletal muscle. Human Calumenin is synthesized as a 315 amino acid precursor that contains a 19 amino acid signal sequence, and a 296 amino acid mature chain. Calumenin localizes to the endoplasmic reticulum (ER) and sarcoplasmic reticulum (SR) of mammalian tissues which plays a role in ER functions as protein folding and sorting. Calumenin is involved in the regulation of vitamin K-dependent carboxylation of multiple N-terminal glutamate residues. It seems to inhibit gamma -carboxylase GGCX.
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 042009-1G , MDL Number: MFCD02094093
Supplier:  Bachem Americas
Description:   Sequence: Fmoc-Aib-OH
Synonym(s): Fmoc-α-Me-Ala-OH
Supplier:  Thermo Scientific Chemicals
Description:   MDL: MFCD00064225 Beilstein Registry No.: 1910407
MSDS SDS

Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 010183-500MG , MDL Number: MFCD06799734

Supplier:  AMBEED, INC
Description:   (S)-2-((((9H-Fluoren-9-yl)methoxy)carbonyl)amino)-3-(2-(trifluoromethyl)phenyl)propanoic acid, Purity: 95%, CAS number: 352523-16-1, Appearance: Form: powder Colour: white, Storage: Sealed in dry, Room Temperature, Size: 1G
Supplier:  AMBEED, INC
Description:   Adenosine 5'-monophosphate sodium salt hydrate ≥98%
New Product
Catalog Number: (103008-568)

Supplier:  Anaspec Inc
Description:   This sequence is amino acids 1 to 20 of influenza A virus hemagglutinin protein (HA2) connected to a 10 amino acid cell permeable HIV Trans-Activator of Transcription (TAT) protein transduction domain (PTD). TAT-HA2 is capable of being used as a large macromolecule drug delivery peptide. The TAT PTD binds to the cell surface and penetrates the membrane via lipid raft-dependent macropinocytosis. Endosomal escape and transduction of the fusion peptide are enhanced by the HA2 domain, which is a pH-sensitive lipid membrane destabilizing sequence.
Sequence: RRRQRRKKRGGDIMGEWGNEIFGAIAGFLG
MW: 3433 Da
% Peak area by HPLC: 95
Storage condition: -20°C
Catalog Number: (75789-618)

Supplier:  Prosci
Description:   Fibroblast Growth Factor Receptor-Like 1 (FGFRL1) is a single-pass type I membrane protein that belongs to the FGF receptor family. The mature human FGFRL1 consists of a 354 amino acid extracellular domain (ECD) with 3 Ig-like C2-type domains, a 21 amino acid transmembrane segment, and a 134 amino acid cytoplasmic domain. FGFR1 expressed in various tissues, preferentially in cartilaginous tissues and pancreas. It highly expressed in the liver, kidney, heart, brain and skeletal muscle, weakly expressed in the lung, small intestine and spleen. FGFRL1 has a negative effect on cell proliferation.
Supplier:  LGC STANDARDS
Description:   2-Amino-N-(2-chloro-6-methylphenyl)-5-thiazolecarboxamide, TRC, LGC Standards
New Product

Supplier:  Prosci
Description:   Protein FAM3D is a novel cytokine-like protein that belongs to the FAM3 family. Human FAM3D is synthesized as a 224 amino acid precursor that contains a 25 amino acid signal sequence and a 199 amino acid mature chain. FAM3D is identified based on structural, but not sequence, homology to short chain cytokines including IL-2, IL-4 and GM-CSF. FAM3 proteins are four helix bundle cytokines with four conserved cysteines in all members (FAM3A-D). FAM3B is highly expressed in alpha and beta cells of the pancreas and is being investigated as a potential contributor to beta cell death and development of Type I Diabetes.
Catalog Number: (75790-206)

Supplier:  Prosci
Description:   Cell Growth Regulator with EF Hand Domain Protein 1 (CGREF1) is a secreted calcium ion binding protein. CGREF1 contains two EF-hand domains and both EF-hands are required for function. Human CGREF1 is synthesized as a 301 amino acid precursor that contains a 19 amino acid signal sequence, and a 282 amino acid mature chain. CGREF1 is probably digested extracellularly by an unknown serine protease generating extremely hydrophobic bioactive peptides. CGREF1 mediates cell-cell adhesion in a calcium-dependent manner. In addition, CGREF1 is able to inhibit growth in several cell lines.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
8,657 - 1  of 1
Prev   3  4  5  6  7  8  9  10  11  12  13  14  15  16  17  18  Next