Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

Methyl+2-amino-3,5-difluorobenzoate


123,969  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"123969"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  Thermo Scientific Chemicals
Description:   O-Methyl-L-tyrosine, 98%
MSDS SDS
Catalog Number: (103003-364)

Supplier:  Anaspec Inc
Description:   Defensins are small cysteine-rich cationic proteins found in both vertebrates and invertebrates. They have host defense properties, and are active against bacteria, fungi and many viruses. Beta-defensins are the most widely distributed, being secreted by leukocytes and epithelial cells of many kinds
Sequence:DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK
(Disulfide bridge: 5-34, 12-27, 17-35)
MW:3929.6 Da
% peak area by HPLC:95
Storage condition:-20° C
Catalog Number: (TS43423-0250)

Supplier:  THERMO FISHER SCIENTIFIC CHEMICALS
Description:   N-Methyl-1,2-phenylenediamine 97%
Supplier:  TCI America
Description:   2-Methylallylamine, Purity: >98.0%(GC)(T), CAS Number: 2878-14-0, Molecular Formula: C4H9N, Molecular Weight: 71.12, Synonyms: 3-Amino-2-methyl-1-propene, Form: Liquid, Clear, Color: Colorless - Pale yellow, Size: 5ML
MSDS SDS
Supplier:  AMBEED, INC
Description:   (E)-N-(2-Amino-4-fluorophenyl)-4-((3-(pyridin-3-yl)acrylamido)methyl)benzamide, Purity: 97%, CAS Number: 1616493-44-7, Appearance: Solid, Storage: Keep in dark place, Inert atmosphere, 2-8C, Size: 5MG
Supplier:  Hardy Diagnostics
Description:   Carbol Fuchsin, Kinyoun for AFB stain, for Mycobacteria
Supplier:  AMBEED, INC
Description:   (S)-3-(((3-Ethyl-5-(2-(2-hydroxyethyl)piperidin-1-yl)pyrazolo[1,5-a]pyrimidin-7-yl)amino)methyl)pyridine 1-oxide, Purity: 98%, CAS Number: 779353-01-4, Appearance: Solid, Storage: Keep in dark place, Inert atmosphere, 2-8 C, Size: 1mg
Supplier:  AMBEED, INC
Description:   (E)-2-Methoxy-N-(3-(4-((3-methyl-4-((6-methylpyridin-3-yl)oxy)phenyl)amino)quinazolin-6-yl)allyl)acetamide, Purity: 98+%, CAS Number: 383432-38-0, Appearance: Form: solid, Storage: Keep in dark place, Sealed in dry, Room Temperature, Size: 10mg
Supplier:  Bioss
Description:   FAM161B is a 647 amino acid protein that belongs to the FAM161 family. The gene that encodes FAM161B consists of approximately 16,413 bases and maps to human chromosome 14q24.3. Housing over 700 genes, chromosome 14 comprises nearly 3.5% of the human genome. Chromosome 14 encodes the Presenilin 1 (PSEN1) gene, which is one of the three key genes associated with the development of Alzheimer?s disease. The SERPINA1 gene is also located on chromosome 14 and, when defective, leads to the genetic disorder 1-antitrypsin deficiency, which is characterized by severe lung complications and liver dysfunction. An inversion of the long arm of chromosome 14 is thought to be involved in T-cell chronic lymphocytic leukemia (CLL), a cancer that affects T lymphocytes.
Supplier:  AMBEED, INC
Description:   4-Methyl-5-(2-((4-morpholinophenyl)amino)pyrimidin-4-yl)thiazol-2-amine, Purity: 98+%, CAS Number: 693228-63-6, Appearance: Yellow solid, Storage: Keep in dark place, Inert atmosphere, Store in freezer, under -20 C, Size: 5mg

Supplier:  Bioss
Description:   DHRS1 (dehydrogenase/reductase (SDR family) member 1), also known as SDR19C1, is a 313 amino acid protein that belongs to the short-chain dehydrogenases/reductases (SDR) family and likely functions as an oxidoreductase. Abundantly expressed in heart and liver, DHRS1 contains an SDR motif and is encoded by a gene that maps to human chromosome 14q12. Human chromosome 14 houses over 700 genes and comprises nearly 3.5% of the human genome. Chromosome 14 encodes the presinilin 1 (PSEN1) gene, which is one of the three key genes associated with the development of Alzheimer's disease (AD). The SERPINA1 gene is also located on chromosome 14 and, when defective, leads to the genetic disorder ?-antitrypsin deficiency, which is characterized by severe lung complications and liver dysfunction.
Supplier:  BeanTown Chemical
Description:   CAS: 14678-02-5; EC No: 238-719-9; MDL No: MFCD00003151 Solid; Molecular Formula: C4H6N2O; MW: 98.10 Melting Point: 85-87°
MSDS SDS
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 042440-1G , MDL Number: MFCD02094111
Supplier:  AMBEED, INC
Description:   Fedratinib (TG101348) 98%
New Product
Supplier:  AMBEED, INC
Description:   (R)-2-((6-(Benzyl(methyl)amino)-9-isopropyl-9H-purin-2-yl)amino)butan-1-ol, Purity: 97%, CAS Number: 866893-90-5, Appearance: Form: powder, Storage: Keep in dark place, Inert atmosphere, Store in freezer, under -20C, Size: 5MG
Supplier:  Ricca Chemical
Description:   Fuchsin-Carbol, Ziehl-Neelsen Formulation, for Staining Acid Fast Organisms
MSDS SDS
Small Business Enterprise
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
4,913 - 4,928  of 123,969