Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

Methyl+acetate


55,723  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"55723"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 


Supplier:  LGC STANDARDS
Description:   Apramycin Acetate - Deuterated, TRC, LGC Standards
New Product
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 054921-1G , MDL Number: MFCD12912655
Supplier:  HCL Label
Description:   These ready-made adhesive vinyl labels comply with the updated OSHA HazCom 'secondary container' labeling requirements.
Supplier:  AMBEED, INC
Description:   2-(3-Chloropropyl)-1,3-dioxolane 98%
New Product
Supplier:  HCL Label
Description:   These ready-made laminated adhesive vinyl labels comply with the updated OSHA HazCom secondary container labeling requirements.
Supplier:  Ricca Chemical
Description:   Acetate Buffer, pH 4.6, for Bromide Analysis, Ricca Chemical Company
MSDS SDS
Small Business Enterprise
Supplier:  Thermo Scientific Chemicals
Description:   Fluorimetric reagent and major catecholamine metabolite
MSDS SDS
Supplier:  TLC PHARMACEUTICAL STANDARD LTD
Description:   Pharmaceutical Standards, Medroxyprogesterone 17-Acetate-d3
New Product
Catalog Number: (103008-246)

Supplier:  Anaspec Inc
Description:   Pramlintide is the first in the new class of amylinomimetic compounds and is a synthetic analogue of the human hormone Amylin, a 37 amino acid peptide. Pramlintide’s peptide sequence differs from Amylin by replacing proline at postitions 25, 28, and 29. Pramlintide has a disulfide bridge between C2 and C7. For Research Use Only.
Sequence: KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2 (S-S Bond) acetate salt
MW: 3949.5 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C
Supplier:  ALADDIN SCIENTIFIC
Description:   Aviptadil acetate
New Product
Supplier:  GROWCELLS
Description:   TAE buffer is used in agarose gel electrophoresis and Polyacrylamide gels both as a buffer and a component of a gel
Supplier:  Matrix Scientific
Description:   Bzl-Gly-OH ≥97%
Supplier:  HCL Label
Description:   These ready-made adhesive vinyl labels comply with the updated OSHA HazCom 'secondary container' labelling requirements.
Supplier:  AMBEED, INC
Description:   tert-Butyl 2-((4R,6S)-6-((E)-2-(4-(4-fluorophenyl)-6-isopropyl-2-(N-methylmethylsulfonamido)pyrimidin-5-yl)vinyl)-2,2-dimethyl-1,3-dioxan-4-yl)acetate 97%
Supplier:  AMBEED, INC
Description:   2-(((1R,2R,3aS,9aS)-2-Hydroxy-1-((S)-3-hydroxyoctyl)-2,3,3a,4,9,9a-hexahydro-1H-cyclopenta[b]naphthalen-5-yl)oxy)acetic acid, sodium salt, Purity: 97%, CAS Number: 289480-64-4, Appearance: White to yellow powder or crystals, Storage: Inert atmosphere, Store in freezer, under -20 C, Size: 10mg
Supplier:  SPEX CERTIPREP LLC
Description:   Single-Component organic standards.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
5,809 - 5,824  of 55,723