Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

Methyl+2-amino-3,5-difluorobenzoate


123,969  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"123969"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  Matrix Scientific
Description:   Methyl-5-oxo-1-piperidin-4-ylpyrrolidine-3-carboxylate ≥97%
Catalog Number: (101418-934)

Supplier:  Strem Chemicals Inc
Description:   BINAP
Catalog Number: (89516-260)

Supplier:  Abgent
Description:   Polyclonal Antibody, Species Reactivity: Human, Mouse, Isotype: Rabbit Ig, Gene ID: 3198, Target/Specificity: This HOXA1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 9-35 amino acids from the N-terminal region of human HOXA1, 1mg
Catalog Number: (101414-092)

Supplier:  Teknova
Description:   Kanamycin sulfate is used for the selection of resistant bacteria.
Supplier:  AOB CHEM USA
Description:   Ethyl 3-methyl-α-oxobenzo[b]thiophene-2-acetate ≥95%
New Product
Supplier:  Matrix Scientific
Description:   MF=C8H4F2O4 MW=202.12 Cas=126120-85-2 MDL=MFCD01631473 ,5G
Catalog Number: (101816-962)

Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 023882-500MG , MDL Number: MFCD03753717
Supplier:  Thermo Scientific Chemicals
Description:   An aminoglycoside antibiotic derived from Kanamycin A.
MSDS SDS

Supplier:  AMBEED, INC
Description:   (2S,3S,4R,5R,6R)-5-Amino-2-(aminomethyl)-6-(((2R,3S,4R,5S)-5-(((1R,2R,3S,5R,6S)-3,5-diamino-2-(((2R,3R,4R,5S,6R)-3-amino-6-(aminomethyl)-4,5-dihydroxytetrahydro-2H-pyran-2-yl)oxy)-6-hydroxycyclohexyl)oxy)-4-hydroxy-2-(hydroxymethyl)tetrahydrofuran-3-yl)oxy)tetrahydro-2H-pyran-3,4-diol xsulfate, 25G
Catalog Number: (89520-514)

Supplier:  Abgent
Description:   Polyclonal antibody, Isotype: Rabbit Ig, Species reactivity: Human, Gene ID: 6129, Target/Specificity: This RPL7 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 6-35 amino acids from the N-terminal region of human RPL7.
Supplier:  AOB CHEM USA
Description:   6-Methyl-2,3-dihydrobenzo[b][1,4]dioxine ≥97%

Supplier:  Anaspec Inc
Description:   A 36-amino acid Cl- channel blocker from Leiurus quinquestriatus scorpion venom.
Sequence:MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR-NH2 (Disulfide bridge: 2-19,5-28,16-33,20-35)
MW:3996 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier:  AMBEED, INC
Description:   6-Methyl-1H-indazole-5-boronic acid ≥98%
New Product
Supplier:  AMBEED, INC
Description:   1-(1-Methyl-1H-imidazol-2-yl)piperazine ≥98%, Ambeed.Inc
New Product
Catalog Number: (89517-132)

Supplier:  Abgent
Description:   Polyclonal Antibody, Host: , Isotype: Rabbit Ig, Species Reactivity: Human, Gene ID: 2149, Target/Specificity: generated from rabbits immunized with a KLH conjugated synthetic peptide between 35-63 amino acids from the N-terminal region of human F2R.
Catalog Number: (89515-194)

Supplier:  Abgent
Description:   polyclonal antibody Isotype: Rabbit Ig, Species Reactivity: human, Gene ID: 5589, Target/specificity: This PRKCSH antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 6-35 amino acids from the N-terminal region of human PRKCSH.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
1,601 - 1,616  of 123,969