Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

Methyl+2-amino-3,5-difluorobenzoate


134,179  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"134179"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 


Supplier:  AMBEED, INC
Description:   2,2-Difluoro-1,3-benzodioxole-5-acetic acid ≥95%
New Product
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 036816-500MG , MDL Number: MFCD07657902

Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 057565-500MG , MDL Number: MFCD00457523
Catalog Number: (TS61129-0050)

Supplier:  THERMO FISHER SCIENTIFIC CHEMICALS
Description:   Kanamycin sulfate
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 043207-5G , MDL Number: MFCD00215246
Supplier:  THERMO FISHER SCIENTIFIC CHEMICALS
Description:   Kanamycin sulfate

Supplier:  Teknova
Description:   Size: 5g.
Supplier:  TCI America
Description:   CAS Number: 624-78-2
MDL Number: MFCD00009030
Molecular Formula: C3H9N
Molecular Weight: 59.11
Purity/Analysis Method: >98.0% (GC)
Form: Clear Liquid
Boiling point (°C): 35
Flash Point (°C): -34
Specific Gravity (20/20): 0.69
Storage Temperature: 0-10°C
MSDS SDS
Supplier:  Thermo Scientific Chemicals
Description:   An aminoglycoside antibiotic derived from Kanamycin A.
MSDS SDS
Supplier:  Chem Impex International
Description:   Purity limit: ≥750 mg/mg (Microbial Assay on Dried Basis)
Supplier:  AMBEED, INC
Description:   2,6-Difluoro-4-methoxyaniline 98%
Catalog Number: (101414-092)

Supplier:  Teknova
Description:   Kanamycin sulfate is used for the selection of resistant bacteria.
Supplier:  Thermo Scientific Chemicals
Description:   5g CAS: 62965-35-9, MDL: MFCD00065574
MSDS SDS

Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 025274-500MG , MDL Number: MFCD09997197

Supplier:  Anaspec Inc
Description:   A 36-amino acid Cl- channel blocker from Leiurus quinquestriatus scorpion venom.
Sequence:MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR-NH2 (Disulfide bridge: 2-19,5-28,16-33,20-35)
MW:3996 Da
% peak area by HPLC:95
Storage condition:-20° C
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 044168-1G , MDL Number: MFCD01568345
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
1,649 - 1,664  of 134,179