Text Search >
1-Azetidinesulfonyl+chloride
Print…
You Searched For:
129,248 results were found
1-Azetidinesulfonyl+chloride
Catalog Number:
(101920-414)
Supplier:
Matrix Scientific
Description:
Matrix Scientific Part Number: 060651-500MG , MDL Number: MFCD18071250
Catalog Number:
(TCC0516-025G)
Supplier:
TCI America
Description:
CAS Number: 116797-51-4
MDL Number: MFCD00151030
Molecular Formula: C3H7NO2S
Molecular Weight: 157.61
Purity/Analysis Method: <gt/>98.0% (T)
Form: Crystal
Supplier:
TCI America
Description:
CAS Number: 78618-06-1
MDL Number: MFCD00270151 Molecular Formula: C14H22N2O2 Molecular Weight: 286.80 Purity/Analysis Method: >98.0% (HPLC,N) Form: Crystal Melting point (°C): 177
Catalog Number:
(89279-748)
Supplier:
Genetex
Description:
Rabbit Polyclonal antibody to Na-independent D-amino acid transporter Purity: Affinity purified using antigen. Species Reactivity: Human Mouse Rat Tested Applications: IHC IM WB Pkg Size: 100 ug
Catalog Number:
(102542-010)
Supplier:
Matrix Scientific
Description:
MF=C8H14CLNO3 MW=207.66 CAS=4644-61-5 MDL=MFCD00043267 5G
Catalog Number:
(103008-568)
Supplier:
Anaspec Inc
Description:
This sequence is amino acids 1 to 20 of influenza A virus hemagglutinin protein (HA2) connected to a 10 amino acid cell permeable HIV Trans-Activator of Transcription (TAT) protein transduction domain (PTD). TAT-HA2 is capable of being used as a large macromolecule drug delivery peptide. The TAT PTD binds to the cell surface and penetrates the membrane via lipid raft-dependent macropinocytosis. Endosomal escape and transduction of the fusion peptide are enhanced by the HA2 domain, which is a pH-sensitive lipid membrane destabilizing sequence.
Sequence: RRRQRRKKRGGDIMGEWGNEIFGAIAGFLG MW: 3433 Da % Peak area by HPLC: 95 Storage condition: -20°C
Supplier:
BeanTown Chemical
Description:
CAS: 51805-45-9; MDL No: MFCD00145469
UN No: UN3261; Haz Class: 8; Packing Group: II
Crystalline/Powder; Molecular Formula: C9H15O6P·HCl ; MW: 286.65
Melting Point: 177-178°
Moisture Sensitive
Supplier:
Matrix Scientific
Description:
MF=C7H14CLNO2 MW=179.65 CAS=80028-44-0 MDL=MFCD14585012 1G
Catalog Number:
(TCT0754-005G)
Supplier:
TCI America
Description:
CAS Number: 6519-67-1
MDL Number: MFCD00067553 Molecular Formula: C13H16N2O2 Molecular Weight: 268.74 Purity/Analysis Method: >99.0% (T) Form: Crystal Color: White
Supplier:
AMBEED, INC
Description:
2-Aminoethyl methacrylate hydrochloride, Purity: 90% contains approx 500 ppm phenothiazine as stabilizer, CAS Number: 2420-94-2, Appearance: Form: solid, Storage: Inert atmosphere, 2-8 C, Size: 250mg
Supplier:
TCI America
Description:
CAS Number: 18807-73-3
MDL Number: MFCD00270149 Molecular Formula: C12H18N2O2 Molecular Weight: 258.75 Purity/Analysis Method: >97.0% (T) Form: Crystal
Supplier:
Thermo Scientific Chemicals
Description:
Angiotensin-converting enzyme inhibitor
Catalog Number:
(10293-658)
Supplier:
Bioss
Description:
The immunophilins are a highly conserved family of cis-trans peptidyl-prolyl isomerases that bind to and mediate the effects of immunosuppressive drugs, such as cyclosporin, FK506 and rapamycin. Immunophilins have also been implicated in protein folding and trafficking within the endoplasmic reticulum (ER). FKBP11 (FK506-binding protein 11), also known as FKBP19 or peptidyl-prolyl cis-trans isomerase FKBP11, is a 201 amino acid single-pass membrane protein belonging to the FKBP-type PPIase family, a group of proteins known to catalyze the folding of proline-containing polypeptides. Containing one PPIase FKBP-type domain, FKBP11 is expressed in secretory tissues such as pancreas, pituitary, stomach, lymph node and salivary gland, and is encoded by a gene that maps to human chromosome 12q13.12. FK506 and rapamycin are known to inhibit FKBP11’s peptidyl-prolyl isomerase activity.
Catalog Number:
(10293-656)
Supplier:
Bioss
Description:
The immunophilins are a highly conserved family of cis-trans peptidyl-prolyl isomerases that bind to and mediate the effects of immunosuppressive drugs, such as cyclosporin, FK506 and rapamycin. Immunophilins have also been implicated in protein folding and trafficking within the endoplasmic reticulum (ER). FKBP11 (FK506-binding protein 11), also known as FKBP19 or peptidyl-prolyl cis-trans isomerase FKBP11, is a 201 amino acid single-pass membrane protein belonging to the FKBP-type PPIase family, a group of proteins known to catalyze the folding of proline-containing polypeptides. Containing one PPIase FKBP-type domain, FKBP11 is expressed in secretory tissues such as pancreas, pituitary, stomach, lymph node and salivary gland, and is encoded by a gene that maps to human chromosome 12q13.12. FK506 and rapamycin are known to inhibit FKBP11’s peptidyl-prolyl isomerase activity.
Supplier:
Thermo Scientific Chemicals
Description:
An A2A Adenosine receptor agonist. CGS 21680 hydrochloride is currently used in research in studying neuronal transmission, also in respiration.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
 is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||
List View
