Text Search >
11-Bromoundecanoic acid
Print…
You Searched For:
87,517 results were found
11-Bromoundecanoic acid
Catalog Number:
(103007-258)
Supplier:
Anaspec Inc
Description:
This peptide is the N-Ethyl-maleimide-sensitive factor (NSF) inhibitor fusion polypeptide composed of 11-amino acid cell permeable HIV transactivating regulatory protein (TAT) domain fused to a 22 amino acid NSF domain. TAT-NSF700 inhibits thrombin-induced exocytosis of endothelial cells in a dose-responsive manner.
Sequence: YGRKKRRQRRR-GGG-LLDYVPIGPRFSNLVLQALLVL MW: 4167 Da % Peak area by HPLC: 95 Storage condition: -20°C
Catalog Number:
(ALA151515-5G)
Supplier:
ALADDIN SCIENTIFIC
Description:
3-Amino-5-phenylpyrazole ((3-phenyl-1H-pyrazol-5-amine) may be used in the synthesis of the following: · Urea derivatives by reaction with azido(6-(benzofuran-2-yl)-2-methylpyridin-3-yl) methanone. · 2-Mercaptoacetamide analogs by treating with thioglycolic acid. · 3-(Substituentpyrimidayl)-5,6-benzocoumarins by treating with 3-(2′-formyl-1′-chlorovinyl)-5,6-benzocoumarin. · Substituted 2,7-diphenylpyrazolo[1,5-a]pyrimidine-5-carboxylic esters by reacting with substituted β-diketo esters. · N-ethoxycarbonylthiourea derivative by reacting with ethoxycarbonyl isothiocyanate. · Heterobiaryl pyrazolo[3,4-b]pyridines by reacting with indole-3-carboxaldehyde.
Catalog Number:
(C-3510.0005BA)
Supplier:
Bachem Americas
Description:
Sequence: Z-Dab(Boc)-OH · DCHA
Catalog Number:
(77561-092)
Supplier:
Sino Biological
Description:
The 39 amino acids of PDKtide peptide sequence ([protein fragment, 39 aa]) is derived from two human proteins: residues 1-14 are based on AKT1 (307-320) and residues 16-39 are based on PKN2/PRK2 (961-984).
Supplier:
AMBEED, INC
Description:
(S)-N-3-Cyanophenylalanine 98%
Supplier:
TCI America
Description:
CAS Number: 144-90-1
MDL Number: MFCD00008145
Molecular Formula: C4H9NO2
Molecular Weight: 103.12
Purity/Analysis Method: <gt/>98.0% (T)
Form: Crystal
Melting point (°C): 174
Supplier:
Bachem Americas
Description:
Sequence: Fmoc-D-allo-Thr-OH
Supplier:
TCI America
Description:
CAS Number: 19794-53-7
MDL Number: MFCD00037773
Molecular Formula: C4H9NO3
Molecular Weight: 119.12
Purity/Analysis Method: <gt/>98.0% (T)
Form: Crystal
Supplier:
Biotium
Description:
This MAb recognizes granulocyte-colony stimulating factor (G-CSF) in the cytoplasm of mature granulocytes. It shows no reactivity with any other cell types. Markers of myeloid cells are useful in the identification of different levels of cellular differentiation. It reacts with early precursor and mature forms of myeloid cells. It is useful for the detection of myeloid leukemias and granulocytic sarcomas. It can be used as a marker of granulocytes in normal tissues or inflammatory processes.G-CSF is a pleiotropic cytokine that influences differentiation, proliferation and activation of the neutrophilic granulocyte lineage. The human G-CSF cDNA encodes a 207 amino acid precursor containing a 29 amino acid signal peptide that is proteolytically cleaved to form a 178 amino acid residue mature protein. Two G-CSF's, which are identical except for a three amino acid deletion in the amino-terminus of one form of the protein have been isolated from human cells. Murine and human G-CSF's share 73% sequence identity at the amino acid level.
CF® dyes are Biotium's next-generation fluorescent dyes. CF®488A is a green fluorescent dye (Ex/Em 490/515 nm) with excellent brightness and photostability. The dye is minimally charged for less non-specific binding. CF®488A also is compatible with super-resolution imaging by TIRF.
Catalog Number:
(E-1915.0100BA)
Supplier:
Bachem Americas
Description:
Sequence: H-Gln-OH
Supplier:
AMBEED, INC
Description:
Boc-D-Glu-OMe 98%
Supplier:
TCI America
Description:
CAS Number: 34404-28-9
MDL Number: MFCD00190790 Molecular Formula: C10H17NO6 Molecular Weight: 247.25 Purity/Analysis Method: >97.0% (HPLC,T) Form: Crystal Melting point (°C): 108 Specific rotation [a]20/D: 14 deg (C=1, MeOH)
Catalog Number:
(102996-412)
Supplier:
Anaspec Inc
Description:
This peptide is PACAP (1-38) with a Biotin label on its N-terminus. Pituitary adenylate cyclase-activating polypeptide (PACAP), a member of the vasoactive intestinal peptide/secretin/glucagon family, has an amino acid sequence identity of 68% with vasoactive intestinal polypeptide (VIP). PACAP38, derived from a 176-amino acid precursor (preproPACAP), is a 38-amino acid peptide discovered as an ovine hypothalamic neuropeptide. The amino acid sequence of PACAP is identical in all mammals, and in species such as chicken, frog, salmon, only 1–3 amino acids are different. It is abundant in both the central and peripheral nervous systems and exerts a variety of effects. PACAP in pancreatic islets may play a parasympathetic and sensory neurotransmitter role. PACAP stimulates insulin secretion from islets in a glucose-dependent manner at femtomolar concentrations, acting as an insulinotropic factor. PACAP and VIP are two multifunctional neuropeptides modulating innate and adaptive immunity. VIP/PACAP protect T cells from activation-induced cell death through down-regulation of Fas ligand. PACAP immunoreactivity has been shown in nerve fibers innervating the intrapancreatic ganglia as well as the islets of Langerhans in pancreas. PACAP (1-38) is more active than VIP in stimulating adenylate cyclase EC50=7 nM.
Sequence: HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKK(Biotin)-NH2 MW: 4888.8 Da % Peak area by HPLC: 95 Storage condition: -20° C
Supplier:
ALADDIN SCIENTIFIC
Description:
2-Aminoterephthalic acid can be used to synthesize:· Lanthanide coordination polymers with 1,10-phenanthroline by hydrothermal method.· Blue-emitting derivatives of 2-aminoterephthalic acid.· Amino-functionalized Zr-terephthalate (UiO-66), an excellent catalyst for selective synthesis of jasminaldehyde.· IRMOF-3, a zinc aminoterephthalate metal-organic framework useful as a catalyst for the Knoevenagel condensation of benzaldehyde and ethyl cyanoacetate.· Polymeric composite membrane with excellent CO2 separation capabilities.
Catalog Number:
(10062-648)
Supplier:
Prosci
Description:
15 amino acid peptide near the carboxy terminus of human PIBF1.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
 is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||
List View
