DAF-FM+diacetate
Catalog Number:
(10281-786)
Supplier:
Bioss
Description:
DAAM2 is a widely expressed 1,068 amino acid protein that contains one DAD domain, one FH1 domain, one FH2 domain and one GBD domain, through which it may play a role in Wnt/Frizzled-associated signaling events. The gene encoding DAAM2 maps to human chromosome 6, which contains 170 million base pairs and comprises nearly 6% of the human genome. Deletion of a portion of the q arm of chromosome 6 is associated with early onset intestinal cancer, suggesting the presence of a cancer susceptibility locus. Additionally, Porphyria cutanea tarda, Parkinson's disease, Stickler syndrome and a susceptibility to bipolar disorder are all associated with genes that map to chromosome 6.
Catalog Number:
(102988-906)
Supplier:
Adipogen
Description:
Modified base of mammalian DNA. Involved in regulation of stem cell processes, cellular development, neurodegeneration and carcinogenesis. Important epigenetic marker. Related to bacimethrin .
Catalog Number:
(10246-972)
Supplier:
Bioss
Description:
Midline-2 is a 715 amino acid protein encoded by the human gene MID2. Midline-2 belongs to the TRIM/RBCC family and contains two B box-type zinc fingers, one B30.2/SPRY domain, one COS domain, one fibronectin type-III domain and one RING-type zinc finger. Midline-2 is a cytoplasmic protein found as a homodimer or heterodimer with Midline-1. It also interacts with IGBP1 (Lymphocyte signaling protein A4). Dimerization is mediated by the tripartite motif (RBCC; RING- and B box-type zinc fingers and coiled coil domains) and microtubule association is dependent on the C-terminal B30.2 domain. Midline-2 is expressed at low levels in fetal kidney and lung, and in adult prostate, ovary and small intestine.
Catalog Number:
(10246-970)
Supplier:
Bioss
Description:
Midline-2 is a 715 amino acid protein encoded by the human gene MID2. Midline-2 belongs to the TRIM/RBCC family and contains two B box-type zinc fingers, one B30.2/SPRY domain, one COS domain, one fibronectin type-III domain and one RING-type zinc finger. Midline-2 is a cytoplasmic protein found as a homodimer or heterodimer with Midline-1. It also interacts with IGBP1 (Lymphocyte signaling protein A4). Dimerization is mediated by the tripartite motif (RBCC; RING- and B box-type zinc fingers and coiled coil domains) and microtubule association is dependent on the C-terminal B30.2 domain. Midline-2 is expressed at low levels in fetal kidney and lung, and in adult prostate, ovary and small intestine.
Supplier:
PeproTech, Inc.
Description:
ApoE belongs to a group of proteins that bind reversibly with lipoprotein and play an important role in lipid metabolism. In addition to facilitating solubilization of lipids, these proteins help to maintain the structural integrity of lipoproteins, serve as ligands for lipoprotein receptors, and regulate the activity of enzymes involved in lipid metabolism. Significant quantities of ApoE are produced in the liver and brain, and to some extent in almost every organ. ApoE is an important constituent of all plasma lipoproteins. Its interaction with specific ApoE receptor enables uptake of chylomicron remnants by liver cells, which is an essential step during normal lipid metabolism. It also binds with the LDL receptor (apo B/E). Defects in ApoE are a cause of hyperlipoproteinemia type III. ApoE exists in three major isoforms; E2, E3, and E4, which differ from one another by a single amino-acid substitution. Individuals heterozygous for the ApoE4 allele are at higher risk of late-onset Alzheimer’s disease. Recombinant Human ApoE4 is a 34.4 kDa protein containing 300 amino acid residues.
Catalog Number:
(103009-746)
Supplier:
Anaspec Inc
Description:
TAU proteins belong to the microtubule-associated protein (MAP) family and are involved in the pathogenesis of Alzheimer’s disease. In the human brain, there are six TAU isoforms ranging from 352 to 441 amino acids in length. These isoforms vary at the carboxyl terminal according to the presence of either three repeat or four repeat domains (R1-R4), in addition to the presence or absence of one or two insert domains at the amino-terminus. Tau Peptide (337-368) is a 32-amino acid long peptide derived from the Repeat 4 domain.
Sequence:VEVKSEKLDFKDRVQSKIGSLDNITHVPGGGN MW:3467.86 Da % peak area by HPLC:95 Storage condition:-20° C
Catalog Number:
(89351-714)
Supplier:
Genetex
Description:
Insulin is one of the major regulatory hormones of intermediate metabolism throughout the body. The biological actions of this hormone involve integration of carbohydrate, protein, and lipid metabolism. Insulin enhances membrane transport of glucose, amino acids, and certain ions. It also promotes glycogen storage,formation of triglycerides and synthesis of proteins and nucleic acids. Immunocytochemical investigations have localized insulin in the B or b-cells of pancreatic islets of Langerhans. Deficiency of insulin results in diabetes mellitus, one of the leading causes of morbidity and mortality in the general population. Insulin is also present in tumors of b-cell origin such as insulinoma.
Catalog Number:
(103010-896)
Supplier:
Anaspec Inc
Description:
AMCA-X, SE is one of the most popular blue fluorescent tagging molecules. It is widely used to label antibodies, proteins and small drug molecules. AMCA-X succinimidyl ester contains a seven-atom aminohexanoyl spacer, the so-called ‘X’ spacer, between the fluorophore and the reactive group. It is well known that the spacer between the fluorophore and the reactive group usually separates the fluorophore from the biomolecule to which it is conjugated, potentially reducing the quenching that typically occurs upon conjugation. In some cases, the ‘X’ spacer allows the dye to be more available for recognition by secondary detection reagents.
Supplier:
TCI America
Description:
[for Biochemical Research]
CAS Number: 536-46-9 MDL Number: MFCD00012991 Molecular Formula: C8H12N2 Molecular Weight: 209.11 Purity/Analysis Method: >99.0% (HPLC,T) Form: Crystal Melting point (°C): 208 Storage Temperature: 0-10°C
Catalog Number:
(10253-366)
Supplier:
Bioss
Description:
MPP3, also known as Discs large homolog 3 (DLG3), is a 585 amino acid protein belonging to the MAGUK family. Proteins in the MAGUK family, including CASK, ZO-1, ZO-2, p55 and MPP2, are known to regulate cell proliferation, intracellular junctions and signaling pathways by interacting with the cytoskeleton. MPP3 contains one guanylate kinase-like domain, one PDZ domain, two L27 domains and one SH3 domain. Via the PDZ domain, MMP3 interacts with the C-terminus of TSLC1. MMP3 has also been found to interact with SR-2A and SR-4.
Supplier:
PeproTech, Inc.
Description:
ApoE belongs to a group of proteins that bind reversibly with lipoprotein and play an important role in lipid metabolism. In addition to facilitating solubilization of lipids, these proteins help to maintain the structural integrity of lipoproteins, serve as ligands for lipoprotein receptors, and regulate the activity of enzymes involved in lipid metabolism. Significant quantities of ApoE are produced in the liver and brain, and to some extent in almost every organ. ApoE is an important constituent of all plasma lipoproteins. Its interaction with specific ApoE receptor enables uptake of chylomicron remnants by liver cells, which is an essential step during normal lipid metabolism. It also binds with the LDL receptor (apo B/E). Defects in ApoE are a cause of hyperlipoproteinemia type III. ApoE exists in three major isoforms; E2, E3, and E4, which differ from one another by a single amino-acid substitution. E3 is the most common isoform and is present in 40-90% of the population. Recombinant Human ApoE3 is a 34.4 kDa protein containing 300 amino acid residues.
Catalog Number:
(10246-966)
Supplier:
Bioss
Description:
Midline-2 is a 715 amino acid protein encoded by the human gene MID2. Midline-2 belongs to the TRIM/RBCC family and contains two B box-type zinc fingers, one B30.2/SPRY domain, one COS domain, one fibronectin type-III domain and one RING-type zinc finger. Midline-2 is a cytoplasmic protein found as a homodimer or heterodimer with Midline-1. It also interacts with IGBP1 (Lymphocyte signaling protein A4). Dimerization is mediated by the tripartite motif (RBCC; RING- and B box-type zinc fingers and coiled coil domains) and microtubule association is dependent on the C-terminal B30.2 domain. Midline-2 is expressed at low levels in fetal kidney and lung, and in adult prostate, ovary and small intestine.
Catalog Number:
(10246-952)
Supplier:
Bioss
Description:
Midline-2 is a 715 amino acid protein encoded by the human gene MID2. Midline-2 belongs to the TRIM/RBCC family and contains two B box-type zinc fingers, one B30.2/SPRY domain, one COS domain, one fibronectin type-III domain and one RING-type zinc finger. Midline-2 is a cytoplasmic protein found as a homodimer or heterodimer with Midline-1. It also interacts with IGBP1 (Lymphocyte signaling protein A4). Dimerization is mediated by the tripartite motif (RBCC; RING- and B box-type zinc fingers and coiled coil domains) and microtubule association is dependent on the C-terminal B30.2 domain. Midline-2 is expressed at low levels in fetal kidney and lung, and in adult prostate, ovary and small intestine.
Catalog Number:
(89351-710)
Supplier:
Genetex
Description:
Insulin is one of the major regulatory hormones of intermediate metabolism throughout the body. The biological actions of this hormone involve integration of carbohydrate, protein, and lipid metabolism. Insulin enhances membrane transport of glucose, amino acids, and certain ions. It also promotes glycogen storage,formation of triglycerides and synthesis of proteins and nucleic acids. Immunocytochemical investigations have localized insulin in the B or b-cells of pancreatic islets of Langerhans. Deficiency of insulin results in diabetes mellitus, one of the leading causes of morbidity and mortality in the general population. Insulin is also present in tumors of b-cell origin such as insulinoma.
Catalog Number:
(10081-604)
Supplier:
Proteintech
Description:
The MAOB gene encodes a 520-amino acid protein with a molecular mass of 58.8 kD and shows 70% amino acid identity to MAOA. MAOA and MAOB are present in the outer mitochondrial membrane in the central nervous system and peripheral tissues.A comparison of highly purified human placental MAOA and human liver MAOB revealed that the A form of the enzyme is larger by 2 kDa and only one potential N-glycosylation site exists in each protein, with each site in a different relevant position.
Catalog Number:
(89350-890)
Supplier:
Genetex
Description:
Ghrelin is an endogenous ligand for the growth hormone secretagogue receptor and is involved in regulating growth hormone release from the pituitary. It has an appetite stimulating effect, induces adiposity, and stimulates gastric acid secretion, and it is involved in growth regulation. Ghrelin is synthesized as a preprohormone, then proteolytically processed to yield a 28 amino acid peptide. An interesting and unique modification is imposed on the hormone during synthesis in the form of an n octanoic acid bound to one of its amino acids. This modification is necessary for biologic activity.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
![]()
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
![]()
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||