Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

(4-Chlorophenyl)acetic acid


21,625  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"21625"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  Thermo Scientific Chemicals
Description:   Powder, 22 mesh. Purity based on metal contaminates only.
MSDS SDS
Supplier:  TCI America
Description:   Dimethyl Dipropargylmalonate, Purity: >98.0%(GC), CAS Number: 63104-44-9, Molecular Formula: C11H12O4, Synonym: Dipropargylmalonic Acid Dimethyl Ester, Form: Crystal-Powder, Solid, Color: White - Pale yellow, Size: 5G
MSDS SDS
Supplier:  Bachem Americas
Description:   Sequence: Fmoc-His(1-Me)-OH
Supplier:  Thermo Scientific Chemicals
Description:   1G
MSDS SDS
Supplier:  TCI America
Description:   4-(Aminomethyl)-1-tert-butoxycarbonylpiperidine, Purity: >98.0%(GC)(T), Cas number: 144222-22-0, Molecular Formula: C11H22N2O2, Molecular Weight: 214.31, Appearance: Clear liquid, Synonyms: 4-(Aminomethyl)-1-Boc-piperidine, Size: 1G
MSDS SDS
Catalog Number: (103007-214)

Supplier:  Anaspec Inc
Description:   This is amino acids 1 to 40 fragment of the beta-amyloid peptide with lysine substituted for glutamic acid at position 22, found in Italian families. The Italian mutation of beta-amyloid 1-40 (E22K) aggregates more rapidly and with more potent neurotoxicity than wild-type beta-amyloid 1-40. The formation of a salt bridge between Lys-22 and Asp-23 in the minor conformer might be a reason why E22K-beta-amyloid 40 is more pathogenic than wild-type beta-amyloid 40.
Sequence: DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVV
Molecular Weight: 4328.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Supplier:  Bioss
Description:   C22orf9 is a 404 amino acid protein that exists as three alternatively spliced isoforms and is encoded by a gene located on human chromosome 22, which contains over 500 genes and about 49 million bases. As the second smallest human chromosome, chromosome 22 contains a wide variety of genes with numerous functions. Phelan-McDermid syndrome, Neurofibromatosis type 2 and autism are associated with chromosome 22. A schizophrenia susceptibility locus has been identified on chromosome 22 and studies show that 22q11 deletion symptoms include a high incidence of schizophrenia. Translocations between chromosomes 9 and 22 may lead to the formation of the Philadelphia Chromosome and the subsequent production of the novel fusion protein, BCR-Abl, a potent cell proliferation activator found in several types of leukemia.
Supplier:  Bachem Americas
Description:   Sequence: H-Trp-OH
Supplier:  AOB CHEM USA
Description:   2-Fluoro-4-formylphenylboronic acid ≥97%
Supplier:  AMBEED, INC
Description:   2,2-Dimethyl-4,7,10-trioxo-3-oxa-5,8,11-triazatridecan-13-oic acid
Supplier:  BeanTown Chemical
Description:   CAS: 108963-96-8; MDL No: MFCD06809720 Solid; Molecular Formula: C11H17NO5; MW: 243.26 Melting Point: 69-74° Optical Rotation: [α]22/D -32.0°, c = 0.5 in chloroform
MSDS SDS
Supplier:  Bioss
Description:   C22orf36 is a 315 amino acid protein that contains two LRR (leucine-rich) repeats and exists as two alternatively spliced isoforms. C22orf36 is encoded by a gene located on human chromosome 22, which contains over 500 genes and about 49 million bases. As the second smallest human chromosome, chromosome 22 contains a wide variety of genes with numerous functions. Phelan-McDermid syndrome, Neurofibromatosis type 2 and autism are associated with chromosome 22. A schizophrenia susceptibility locus has been identified on chromosome 22 and studies show that 22q11 deletion symptoms include a high incidence of schizophrenia. Translocations between chromosomes 9 and 22 may lead to the formation of the Philadelphia Chromosome and the subsequent production of the novel fusion protein, BCR-Abl, a potent cell proliferation activator found in several types of leukemia.
Catalog Number: (77004-566)

Supplier:  AMBEED, INC
Description:   2,2',2'',2'''-(((3',6'-Dihydroxy-3-oxo-3H-spiro[isobenzofuran-1,9'-xanthene]-2',7'-diyl)bis(methylene))bis(azanetriyl))tetraacetic acid, Purity: AR, CAS: 1461-15-0, Appearance: Yellow to orange to red-brown powder or crytals, Storage: Keep in dark place, Sealed in dry, Room Temperature, Size: 1MG
Supplier:  TCI America
Description:   2,7-Bis(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-9,9-dimethylfluorene, Purity: >98%, CAS: 325129-69-9, MF: C27H36B2O4, MW: 446.20, Synonyms: 9,9-Dimethylfluorene-2,7-diboronic Acid Bis(pinacol) Ester, Size: 1G
Supplier:  Qorpak
Description:   Green Thermoset Plastic Caps with F217 and PTFE liners are known for providing the widest range of chemical compatibility.
Supplier:  TCI America
Description:   CAS Number: 121343-82-6
MDL Number: MFCD00237657
Molecular Formula: C20H19NO6
Molecular Weight: 369.37
Purity/Analysis Method: >98.0% (HPLC,T)
Form: Crystal
Specific rotation [a]20/D: -22 deg (C=1, DMF)
MSDS SDS
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
193 - 208  of 21,625