Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

Methyl+3-aminocyclohexanecarboxylate+hydrochloride


30,530  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"30530"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  Novus Biologicals
Description:   beta Glucuronidase Overexpression Lysate (Adult Normal)
Supplier:  Novus Biologicals
Description:   lactamase, beta 2 Overexpression Lysate (Adult Normal)
Supplier:  Novus Biologicals
Description:   p66 beta Overexpression Lysate (Adult Normal)
Catalog Number: (103007-602)

Supplier:  Anaspec Inc
Description:   Several mutations in the beta amyloid precursor gene cause autosomal dominant Alzheimer's Disease in a number of kindreds. Among them, the English mutation, with His at position 6 replaced with Arg, was reported to accelerate the kinetics of oligomers formation which act as fibril seeds and are more toxic to cultured neuronal cells.
Sequence: DAEFRRDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight: 4348.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Supplier:  Novus Biologicals
Description:   The Beta-endorphin Antibody (B31.15) from Novus Biologicals is a mouse monoclonal antibody to Beta-endorphin. This antibody reacts with human. The Beta-endorphin Antibody (B31.15) has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen.

Supplier:  Novus Biologicals
Description:   The Tubulin Beta 2C Antibody from Novus Biologicals is a rabbit polyclonal antibody to Tubulin Beta 2C. This antibody reacts with human, mouse. The Tubulin Beta 2C Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry / Immunofluorescence, Immunohistochemistry-Paraffin.
Catalog Number: (76741-180)

Supplier:  ANTIBODIES.COM LLC
Description:   Human TGF beta Receptor I ELISA kit is a sandwich Enzyme-Linked Immunosorbent Assay (sELISA) designed for the <i>in vitro</i> quantitative determination of human TGF beta Receptor I in serum, plasma, tissue homogenates, and other biological fluids.
Supplier:  Biotium
Description:   Estrogen Receptor beta 1 Monoclonal antibody, Clone: ESR2/686, Host: Mouse, Species reactivity: Human, Isotype: IgG's, Conjugate: CF640R, Immunogen: C-terminus fragment, Synonyms: Erb, ESR BETA, ESR2, Application: IF, IHC, WB, FC, Size: 100uL
Supplier:  Biotium
Description:   Estrogen Receptor beta 1 Monoclonal antibody, Clone: ESR2/686, Host: Mouse, Species reactivity: Human, Isotype: IgG's, Conjugate: CF594, Immunogen: C-terminus fragment, Synonyms: Erb, ESR BETA, ESR2, Application: IF, IHC, WB, FC, Size: 100uL
Catalog Number: (89349-230)

Supplier:  Genetex
Description:   Rabbit polyclonal antibody to beta-Adaptin (adaptor-related protein complex 1, beta 1 subunit)

Supplier:  R&D Systems
Description:   IFN-alpha/beta R2 Polyclonal Antibody, Host: Goat, Reactivity: Mouse, Isotype: IgG, Format: Fluorescein, Immunogen: Mouse myeloma cell line NS0-derived recombinant mouse IFN-alpha / beta R2, Synonym: NK cell receptor, Application: Flow cytometry, Size: 100 Tests
Supplier:  Bioss
Description:   Integrin alpha-L/beta-2 is a receptor for ICAM1, ICAM2, ICAM3 and ICAM4. Integrins alpha-M/beta-2 and alpha-X/beta-2 are receptors for the iC3b fragment of the third complement component and for fibrinogen. Integrin alpha-X/beta-2 recognizes the sequence G-P-R in fibrinogen alpha-chain. Integrin alpha-M/beta-2 recognizes P1 and P2 peptides of fibrinogen gamma chain. Integrin alpha-M/beta-2 is also a receptor for factor X. Integrin alpha-D/beta-2 is a receptor for ICAM3 and VCAM1. Triggers neutrophil transmigration during lung injury through PTK2B/PYK2-mediated activation.
Catalog Number: (103594-084)

Supplier:  Sino Biological
Description:   Produced in rabbits immunized with purified, recombinant Mouse IL-1 beta (rM IL-1 beta; Catalog#50101-MNAE; P10749; Val118-Ser269). IL-1 beta specific IgG was purified by Mouse IL-1 beta affinity chromatography.
Catalog Number: (89349-032)

Supplier:  Genetex
Description:   Rabbit Polyclonal antibody to beta Catenin (catenin (cadherin-associated protein), beta 1, 88kDa)
Catalog Number: (89282-378)

Supplier:  Genetex
Description:   Rabbit polyclonal antibody to TGF beta Receptor 2

Supplier:  Genetex
Description:   Mouse monoclonal antibody [4B7R] to Integrin beta 1 / CD29
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
5,441 - 5,456  of 30,530