Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

Methyl-3,5-difluorobenzoate


62,306  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"62306"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Catalog Number: (700005-826)

Supplier:  Spectrum Chemicals
Description:   Decanedioic Acid Diethyl Ester. CAS: 110-40-7. Size: 35 kg.
Small Business Enterprise
Catalog Number: (89007-840)

Supplier:  Brady Worldwide
Description:   Versatile sign posts for permanent or temporary use

Supplier:  Anaspec Inc
Description:   A 36-amino acid Cl- channel blocker from Leiurus quinquestriatus scorpion venom.
Sequence:MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR-NH2 (Disulfide bridge: 2-19,5-28,16-33,20-35)
MW:3996 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier:  United Scientific Supplies
Description:   Cork stoppers function as a closure for bottles, vials, laboratory vessels and other openings.
Supplier:  THERMO FISHER SCIENTIFIC CHEMICALS
Description:   4-(Chloromethyl)benzyl alcohol 97%
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 042767-1G , MDL Number: MFCD03791142
Supplier:  Ace Glass
Description:   These bushing-type adapters are manufactured from polytetrafluoroethylene.
Small Business Enterprise Product available on GSA Advantage®
Supplier:  AMBEED, INC
Description:   (S)-2-Amino-3-(1H-imidazol-4-yl)propanoic acid hydrochloride, Purity: 97%, CAS Number: 645-35-2, Appearance: White to yellow powder or crystals, Storage: Keep in dark place, Inert atmosphere, Room temperature, Size: 25G
Supplier:  MilliporeSigma
Description:   Clear liquid. For low level trace metal analysis. Double-distilled and packaged in ISO Class 4 (FED-STD-209E Class 10/M2.5) cleanroom conditions. Supplied in specially designed, preleached fluoropolymer resin bottles to guarantee product integrity. Certificate of Analysis supplied.
MSDS SDS
Supplier:  Wilmad-LabGlass
Description:   These borosilicate glass gas washing bottles are generally used to saturate or dry gas streams.
Supplier:  Electron Microscopy Sciences
Description:   The strainers are available in the sizes of 35, 40, 70 and 100 microns.
Minority or Woman-Owned Business Enterprise
Supplier:  Foxx Life Sciences
Description:   Imapex™ Peroxide Grade silicone tubing is designed for non-critical fluid transfer, peristaltic pump use, and general engineering applications.
Supplier:  AMBEED, INC
Description:   Ethyl nitroacetate 99%
Supplier:  Thermco
Description:   These high precision liquid-in-glass mercury thermometers are hand blown, which bear graduations, numbers and letters etched into the glass and filled with and inert gas above the mercury column
MSDS SDS
Catalog Number: (TCT2426-25G)

Supplier:  TCI America
Description:   CAS Number: 1070-78-6 MDL Number: MFCD00054655 Molecular Formula: C3H4Cl4 Molecular Weight: 181.87 Purity/Analysis Method: <gt/>98.0% (GC) Form: Clear Liquid Color: Colorless Boiling point (°C): 159 Melting point (°C): -35 Specific Gravity (20/20): 1.47
MSDS SDS
Catalog Number: (101925-768)

Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 063464-500MG , MDL Number: MFCD15146451
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
7,633 - 7,648  of 62,306