Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

2-Bromo-1-iodo-4-(trifluoromethoxy)benzene


174,368  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"174368"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  Restek
Description:   The ideal column for carbonyls, fatty acids, glycerides, anilines, fat-soluble vitamins, phthalates, barbiturates, steroids, PTH amino acids, and other acids.
Catalog Number: (ALA151515-5G)

Supplier:  ALADDIN SCIENTIFIC
Description:   3-Amino-5-phenylpyrazole ((3-phenyl-1H-pyrazol-5-amine) may be used in the synthesis of the following: · Urea derivatives by reaction with azido(6-(benzofuran-2-yl)-2-methylpyridin-3-yl) methanone. · 2-Mercaptoacetamide analogs by treating with thioglycolic acid. · 3-(Substituentpyrimidayl)-5,6-benzocoumarins by treating with 3-(2′-formyl-1′-chlorovinyl)-5,6-benzocoumarin. · Substituted 2,7-diphenylpyrazolo[1,5-a]pyrimidine-5-carboxylic esters by reacting with substituted β-diketo esters. · N-ethoxycarbonylthiourea derivative by reacting with ethoxycarbonyl isothiocyanate. · Heterobiaryl pyrazolo[3,4-b]pyridines by reacting with indole-3-carboxaldehyde.
New Product
Catalog Number: (10426-684)

Supplier:  Bioss
Description:   The protein encoded by ANP32C is one of at least two proteins that are similar in amino acid sequence to PP32 and are part of the same acidic nuclear phosphoprotein gene family. However, unlike PP32, the encoded protein is tumorigenic. The tumor suppressor function of PP32 has been localized to a 25 amino acid region that is divergent between PP32 and the protein encoded by this gene. This gene does not contain introns.
Supplier:  TCI America
Description:   CAS Number: 34404-28-9
MDL Number: MFCD00190790
Molecular Formula: C10H17NO6
Molecular Weight: 247.25
Purity/Analysis Method: >97.0% (HPLC,T)
Form: Crystal
Melting point (°C): 108
Specific rotation [a]20/D: 14 deg (C=1, MeOH)
MSDS SDS
Supplier:  AMBEED, INC
Description:   Fmoc-HoPhe-OH, Purity: 97%, CAS number: 132684-59-4, Appearance: Form: Crystal - Powder / Colour: White - Almost white, Storage: Keep in dark place, Sealed in dry, Room Temperature, Size: 1G
Supplier:  Macherey-Nagel
Description:   These glass plates with a special layer are used for TLC enantiomer separations (e.g. amino acids, thiazolidine derivatives, dipeptides, lactones, α-hydroxycarboxylic acids).
Small Business Enterprise
Catalog Number: (89310-892)

Supplier:  Genetex
Description:   Rabbit polyclonal antibody to FURIN (furin (paired basic amino acid cleaving enzyme))
Catalog Number: (76839-170)

Supplier:  AMBEED, INC
Description:   H-D-Asp(OMe)-OH·HCl 97%
Supplier:  TCI America
Description:   CAS Number: 19794-53-7 MDL Number: MFCD00037773 Molecular Formula: C4H9NO3 Molecular Weight: 119.12 Purity/Analysis Method: <gt/>98.0% (T) Form: Crystal
MSDS SDS

Supplier:  Anaspec Inc
Description:   This peptide is PACAP (1-38) with a Biotin label on its N-terminus. Pituitary adenylate cyclase-activating polypeptide (PACAP), a member of the vasoactive intestinal peptide/secretin/glucagon family, has an amino acid sequence identity of 68% with vasoactive intestinal polypeptide (VIP). PACAP38, derived from a 176-amino acid precursor (preproPACAP), is a 38-amino acid peptide discovered as an ovine hypothalamic neuropeptide. The amino acid sequence of PACAP is identical in all mammals, and in species such as chicken, frog, salmon, only 1–3 amino acids are different. It is abundant in both the central and peripheral nervous systems and exerts a variety of effects. PACAP in pancreatic islets may play a parasympathetic and sensory neurotransmitter role. PACAP stimulates insulin secretion from islets in a glucose-dependent manner at femtomolar concentrations, acting as an insulinotropic factor. PACAP and VIP are two multifunctional neuropeptides modulating innate and adaptive immunity. VIP/PACAP protect T cells from activation-induced cell death through down-regulation of Fas ligand. PACAP immunoreactivity has been shown in nerve fibers innervating the intrapancreatic ganglia as well as the islets of Langerhans in pancreas. PACAP (1-38) is more active than VIP in stimulating adenylate cyclase EC50=7 nM.
Sequence: HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKK(Biotin)-NH2
MW: 4888.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 042289-1G , MDL Number: MFCD01076232
Catalog Number: (76803-338)

Supplier:  AMBEED, INC
Description:   (S)-2-((((9H-Fluoren-9-yl)methoxy)carbonyl)amino)-2-methyl-3-phenylpropanoic acid, Purity: 95%, CAS Number: 135944-05-7, Appearance: White to off-white powder or crystals, Storage: Sealed in dry, 2-8C, Size: 100MG
Catalog Number: (E-1915.0100BA)

Supplier:  Bachem Americas
Description:   Sequence: H-Gln-OH
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 042009-1G , MDL Number: MFCD02094093
Supplier:  BeanTown Chemical
Description:   CAS: 56-85-9; EC No: 200-292-1; MDL No: MFCD00008044; RTECS: MA2275100 Powder; Molecular Formula: C5H10N2O3; MW: 146.14 Melting Point: 185° (decomposes)
MSDS SDS
Supplier:  PeproTech, Inc.
Description:   The Trefoil Factor peptides (TFF1, TFF2 and TFF3) are secreted in the gastrointestinal tract, and appear to play an important role in intestinal mucosal defense and repair. TFF-3 is expressed by goblet cells and in the uterus, and has also been shown to be expressed in certain cancers, including colorectal, hepatocellular, and in biliary tumors. TFF3 may be useful as a molecular marker for certain types of cancer, but its role, if any, in tumorigenesis is unknown. TFF3 also promotes airway epithelial cell migration and differentiation. Recombinant Human TFF-3 is a 13.2 kDa homodimeric protein consisting of two 59 amino acid chains, which includes a 40-amino acid trefoil motif containing three conserved intramolecular disulfide bonds.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
4,721 - 4,736  of 174,368