Text Search >
\\\\\\\\\\\\\\\\u03B2-Chloropropiophenone
Print…
You Searched For:
74,071 results were found
\\\\\\\\\\\\\\\\u03B2-Chloropropiophenone
Catalog Number:
(10751-996)
Supplier:
Prosci
Description:
AKT1S1 Antibody: The Akt signaling pathway contributes to the regulation of apoptosis after a variety of cell death signals. AKT1S1, also known as PRAS40, is a proline-rich substrate of the kinase AKT1 and is thought to play a role in neuroprotection mediated by nerve growth factor (NGF) after transient focal cerebral ischemia. AKT1S1 is also a substrate and potential regulator of mammalian target of rapamycin (mTOR), a serine/threonine kinase that regulates cell growth and cell cycle, and a negative regulator of autophagy. Treatment with the insulin-like growth factor-1 (IGF1) can indusce the phosphorylation of AKT1S1 via the PI3K/AKT signaling pathway in PC12 cells.
Catalog Number:
(10062-532)
Supplier:
Prosci
Description:
SHISA3 Antibody: SHISA3 plays an essential role in the maturation of presomitic mesoderm cells by individual attenuation of both FGF and WNT signaling. The Shisa family of single-transmembrane proteins is characterized by an N-terminal cysteine-rich domain and a proline-rich C-terminal region. Its founding member, Xenopus Shisa, promotes head development by antagonizing Wnt and FGF signaling. Shisa physically interacted with immature forms of the Wnt receptor Frizzled and the FGF receptor within the ER and inhibited their posttranslational maturation and trafficking to the cell surface. Loss of Shisa function sensitized the neuroectoderm to Wnt signaling and suppressed head formation during gastrulation.
Catalog Number:
(75932-938)
Supplier:
Rockland Immunochemical
Description:
The Hox proteins play a role in patterns of embryonic development and cellular differentiation by regulating downstream target genes. TLX1, also called homeobox11 (HOX11), as it is located outside of the four mammalian Hox clusters, is a DNA-binding nuclear transcription factor. TLX1 encodes a homeobox-domain containing protein and is containing a glycine and proline-rich amino terminus. TLX1 is required for maintenance of the developing spleen and cell survival. TLX1 is highly expressed in T-cell leukemia and lymphoid neoplasias as a result of translocation. TLX1-deficient mice have no spleen.
Catalog Number:
(102998-454)
Supplier:
Anaspec Inc
Description:
A 32-amino acid long peptide with a disulfide bridge between Cys1 and Cys7 and C-terminal amidated Proline, Calcitonin (CT) is involved plasma calcium level. Compared to human or rat calcitonin, Salmon Calcitonin (sCT) is more potent in its biological actions such as inhibition of osteoclasts resorption of bones, renal ion excretion modulation, and others. The reason for its potency has been attributed to the fact that sCT forms an amphipathic helix in its amino acids 9-19 region.
Sequence: CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 (Disulfide bridge: 1-7) MW: 3431.9 Da % Peak area by HPLC: 95 Storage condition: -20° C
Catalog Number:
(10332-348)
Supplier:
Bioss
Description:
Catalyzes the calcium-dependent formation of isopeptide cross-links between glutamine and lysine residues in various proteins, as well as the conjugation of polyamines to proteins. Involved in the formation of the cornified envelope (CE), a specialized component consisting of covalent cross-links of proteins beneath the plasma membrane of terminally differentiated keratinocytes. Catalyzes small proline-rich proteins (SPRR1 and SPRR2) and LOR cross-linking to form small interchain oligomers, which are further cross-linked by TGM1 onto the growing CE scaffold (By similarity). In hair follicles, involved in cross-linking structural proteins to hardening the inner root sheath.
Catalog Number:
(10266-386)
Supplier:
Bioss
Description:
Polyglutamine(Q) tract binding protein-1 (PQBP-1) is a transcription repressor that associates with polyglutamine tract-containing transcription regulators and causative genes for neurodegenerative disorders. Hepta- and di-amino acid repeat sequences rich in polar residues are essential for PQBP-1 to interact with polyglutamine tract-containing proteins (i.e. huntingtin, androgen receptor and Brain-2). PQBP-1 contains a WWP/WW domain that binds proline-rich motifs and a C2 domain that can influence Ca2+-dependent phospholipid signaling. PQBP-1 localizes to the nucleus and is present in neurons throughout the brain, with abundant levels in hippocampus, cerebellar cortex and olfactory bulb. The human PQBP-1 gene maps to chromosome Xp11.23.
Catalog Number:
(75789-108)
Supplier:
Prosci
Description:
Peptidyl-prolyl cis-trans isomerase E, also known as Cyclophilin E, Cyclophilin-33, Rotamase E, CYP33, PPIE, is an enzyme which belongs to the cyclophilin-type PPIase family of PPIase E subfamily. PPIE found in all the examined tissues including heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. PPIE contains one PPIase cyclophilin-type domain and one RRM (RNA recognition motif) domain. PPIE accelerates the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. PPIE combines RNA-binding and PPIase activities. It may be involved in muscle- and brain-specific processes and pre-mRNA splici
Catalog Number:
(10799-520)
Supplier:
Rockland Immunochemical
Description:
AATK or apoptosis-associated tyrosine kinase contains a tyrosine kinase domain at the N-terminus and a proline-rich domain at the C-terminus. AATK is induced during apoptosis, and expression of this protein is a necessary pre-requisite for the induction of growth arrest and/or apoptosis of myeloid precursor cells (1). AATK is highly detected in brain, lung, kidney, and pancreas (2). AATK is also shown to produce neuronal differentiation in a neuroblastoma cell line. AATK Protein is ideal for investigators involved in Signaling Proteins , Cellular Proteins, Apoptosis/Autophagy, Cancer, and Cytoplasmic Tyrosine Kinase research.
Catalog Number:
(10751-716)
Supplier:
Prosci
Description:
CASKIN1 Antibody: Calcium/calmodulin-dependent serine protein kinase (CASK) is a conserved multi-domain scaffolding protein involved in brain development, synapse formation, and establishment of cell polarity. CASKINs (CASK interacting proteins) interact with CASK and is thought to play a role in CASK function, specifically by coupling CASK to distinct downstream effectors. CASKIN1 is a multidomain protein containing six N-terminal ankyrin repeats, one SH3 domain, and two sterile alpha motif domains followed by a long proline-rich sequence and a short conserved C-terminal domain. CASKIN1 coassembles with CASK on the cytoplasmic tail of neurexin 1, suggesting that CASKIN and CASK coat the cytoplasmic tails of neurexins and other cell-surface proteins.
Catalog Number:
(10467-460)
Supplier:
Bioss
Description:
LAP3 (leucine aminopeptidase 3), also known as LAPEP or PEPS, is a 519 amino acid protein that localizes to the cytoplasm and belongs to the peptidase M17 family. Existing as a homohexamer, LAP3 uses zinc as a cofactor to catalyze the release of an N-terminal proline from a target peptide and is, therefore, involved in the processing and turnover of intracellular proteins. Multiple isoforms of LAP3 exist due to alternative splicing events. The gene encoding LAP3 maps to human chromosome 4, which houses nearly 6% of the human genome and has the largest gene deserts (regions of the genome with no protein encoding genes) of all of the human chromosomes. Defects in some of the genes located on chromosome 4 are associated with Huntington's disease, Ellis-van Creveld syndrome, methylmalonic acidemia and polycystic kidney disease.
Catalog Number:
(102552-806)
Supplier:
BioVendor
Description:
C1q- and tumor necrosis factor-related protein, CTRP or C1QTNF, is a rapidly-expanding cytokine family. There are 13 members of the CTRP family that have been identified. Each CTRP is comprised of the NH2 terminal half representing a proline-rich collagen domain preceded by a signal sequence and a hypervariable region, which can accelerate multimeric forms, and the COOH terminal half globular domain resembling TNF-α and RANKL in terms of 3D structure. Their overall structure is very similar to adiponectin. Therefore, CTRPs are the adiponectin paralogs. One interesting feature of the CTRP family is that their amino acids are quite conserved between species, implying their biological importance.
Catalog Number:
(76084-498)
Supplier:
Bioss
Description:
Vasodilator-stimulated phosphoprotein (VASP) is a member of the Ena-VASP protein family. Ena-VASP family members contain an EHV1 N-terminal domain that binds proteins containing E/DFPPPPXD/E motifs and targets Ena-VASP proteins to focal adhesions. In the mid-region of the protein, family members have a proline-rich domain that binds SH3 and WW domain-containing proteins. Their C-terminal EVH2 domain mediates tetramerization and binds both G and F actin. VASP is associated with filamentous actin formation and likely plays a widespread role in cell adhesion and motility. VASP may also be involved in the intracellular signaling pathways that regulate integrin-extracellular matrix interactions. VASP is regulated by the cyclic nucleotide-dependent kinases PKA and PKG.
Catalog Number:
(103007-178)
Supplier:
Anaspec Inc
Description:
This C-terminal Exendin 4 Trp Cage variant is known as TC5b and can be used an for simulation studies of protein folding. This 20-residue construct is over 95% folded in water at physiological pH, and exhibits a tightly folded tertiary structure in solution. Trp Cage is a highly stable mini-protein fold. It consists of a short helix, a 3,10 helix and a C-terminal poly-proline that packs against a Trp in the alpha helix. It is known to fold within 4 nanoseconds. This stable fast-folding Trp Cage sequence displays special stabilizing features specific to this miniprotein.
Sequence: NLYIQWLKDGGPSSGRPPPS MW: 2169.4 Da % Peak area by HPLC: 95 Storage condition: -20° C
Supplier:
Biotium
Description:
This antibody recognizes a protein of 40 kDa, identified as CD7, a member of the immunoglobulin gene superfamily. Its N-terminal amino acids 1-107 are highly homologous to Ig kappa-L chains whereas the carboxyl-terminal region of the extracellular domain is proline-rich and has been postulated to form a stalk from which the Ig domain projects. CD7 is expressed on the majority of immature and mature T-lymphocytes, and T cell leukemia. It is also found on natural killer cells, a small subpopulation of normal B cells and on malignant B cells. Cross-linking surface CD7 positively modulates T cell and NK cell activity as measured by calcium fluxes, expression of adhesion molecules, cytokine secretion and proliferation. CD7 associates directly with phosphoinositol 3'-kinase. CD7 ligation induces production of D-3 phosphoinositides and tyrosine phosphorylation.
Catalog Number:
(10332-346)
Supplier:
Bioss
Description:
Catalyzes the calcium-dependent formation of isopeptide cross-links between glutamine and lysine residues in various proteins, as well as the conjugation of polyamines to proteins. Involved in the formation of the cornified envelope (CE), a specialized component consisting of covalent cross-links of proteins beneath the plasma membrane of terminally differentiated keratinocytes. Catalyzes small proline-rich proteins (SPRR1 and SPRR2) and LOR cross-linking to form small interchain oligomers, which are further cross-linked by TGM1 onto the growing CE scaffold (By similarity). In hair follicles, involved in cross-linking structural proteins to hardening the inner root sheath.
Supplier:
Adipogen
Description:
Actinomycin X2 is an anti-tumor and anti-viral antibiotic.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
 is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||
List View
