Mono-n-dodecyl+phosphate
Catalog Number:
(77438-154)
Supplier:
Bioss
Description:
Intracellular calcium concentrations are regulated by a family of inositol phosphates, which act as second messengers in the calcium cell signaling pathway. ITPK1 (inositol 1,3,4-triphosphate 5/6 kinase), also known as ITRPK1, is a 414 amino acid monomer that belongs to the ITPK1 family and exists as two alternatively spliced isoforms. Widely expressed, ITPK1 is found at highest levels in brain, followed by heart, skeletal muscle, kidney, pancreas, liver, placenta and lung. ITPK1 contains one ATP-grasp domain and has been found to phosphorylate various.
Catalog Number:
(10452-250)
Supplier:
Bioss
Description:
Transport of phosphorylated lysosomal enzymes from the Golgi complex and the cell surface to lysosomes. Lysosomal enzymes bearing phosphomannosyl residues bind specifically to mannose-6-phosphate receptors in the Golgi apparatus and the resulting receptor-ligand complex is transported to an acidic prelyosomal compartment where the low pH mediates the dissociation of the complex. This receptor also binds IGF2. Acts as a positive regulator of T-cell coactivation, by binding DPP4.
Catalog Number:
(10452-256)
Supplier:
Bioss
Description:
Transport of phosphorylated lysosomal enzymes from the Golgi complex and the cell surface to lysosomes. Lysosomal enzymes bearing phosphomannosyl residues bind specifically to mannose-6-phosphate receptors in the Golgi apparatus and the resulting receptor-ligand complex is transported to an acidic prelyosomal compartment where the low pH mediates the dissociation of the complex. This receptor also binds IGF2. Acts as a positive regulator of T-cell coactivation, by binding DPP4.
Catalog Number:
(10813-690)
Supplier:
Prosci
Description:
Transport of phosphorylated lysosomal enzymes from the Golgi complex and the cell surface to lysosomes. Lysosomal enzymes bearing phosphomannosyl residues bind specifically to mannose-6-phosphate receptors in the Golgi apparatus and the resulting receptor-ligand complex is transported to an acidic prelyosomal compartment where the low pH mediates the dissociation of the complex. This receptor also binds IGF2. Acts as a positive regulator of T-cell coactivation, by binding DPP4.
Catalog Number:
(10077-872)
Supplier:
Prosci
Description:
Sphingosine kinase (SPHK) phosphorylates sphingosine to form a bioactive lipid mediate, sphingosine 1-phosphate (S1P or SPP). S1P is a novel lipid messenger with both intracellular and extracellular functions. Intracellularly, it regulates proliferation and survival while extracellularly it is a ligand for EDG 1. Expression of SPHK1 and subsequent production of S1P promotes the G1-S transition, protects cells from apoptosis, stimulates migration and angiogenesis, and induces tumor formation in mice.
Catalog Number:
(102996-410)
Supplier:
Anaspec Inc
Description:
Parathyroid hormone (PTH) regulates the metabolism of calcium and phosphate. PTH and PTH-related polypeptide (PTHrP) play important roles in calcium homeostasis of bone, kidney, breast, and placenta; they signal via the PTH/PTHrP and PTH2 receptors. PTH(1–34) administration suppresses cardiovascular calcification and down-regulates aortic osteogenic programs driven by diabetes and dyslipidemia.
Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFK(Biotin) MW: 4472.2 Da % Peak area by HPLC: 95 Storage condition: -20° C
Catalog Number:
(10346-266)
Supplier:
Bioss
Description:
Key component of innate and adaptive immunity. TLRs (Toll-like receptors) control host immune response against pathogens through recognition of molecular patterns specific to microorganisms. TLR9 is a nucleotide-sensing TLR which is activated by unmethylated cytidine-phosphate-guanosine (CpG) dinucleotides. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Controls lymphocyte response to Helicobacter infection.
Catalog Number:
(10469-050)
Supplier:
Bioss
Description:
Regulates RHOA activity, and plays a role in cytoskeleton remodeling. Necessary for normal completion of cytokinesis. Plays a role in maintaining normal diacylglycerol levels in the Golgi apparatus. Binds phosphatidyl inositol phosphates (in vitro). May catalyze the transfer of phosphatidylinositol and phosphatidylcholine between membranes (By similarity). Necessary for maintaining the normal structure of the endoplasmic reticulum and the Golgi apparatus. Required for protein export from the endoplasmic reticulum and the Golgi. Binds calcium ions.
Catalog Number:
(103853-724)
Supplier:
BioVendor
Description:
Quality control test, Indirect ELISA – to determine titer of the antibody , SDS PAGE – to determine purity of the antibody, and BCA - to determine quantity of the antibody.
Catalog Number:
(RL712-1831)
Supplier:
Rockland Immunochemical
Description:
Supplied in pH 7.6 buffer (10 mM Sodium Phosphate 250 mM NaCl) Suitable for immunomicroscopy and flow cytometry or FACS analysis as well as other antibody based fluorescent assays requiring extremely low background levels, absence of F(c) mediated binding, lot-to-lot consistency, high titer and specificity.
Catalog Number:
(10257-146)
Supplier:
Bioss
Description:
Receptor for the lysosphingolipid sphingosine 1-phosphate (S1P). S1P is a bioactive lysophospholipid that elicits diverse physiological effect on most types of cells and tissues. Is coupled to both the G(i/0)alpha and G(12) subclass of heteromeric G-proteins (By similarity). May play a regulatory role in the transformation of radial glial cells into astrocytes and may affect proliferative activity of these cells.
Catalog Number:
(76199-366)
Supplier:
Immunoreagents
Description:
For the removal of cross-reactivity to rabbit immunoglobulins.
Supplier:
VWR International
Description:
Ideal for general laboratory use or for volatile organic analysis.
![]()
Catalog Number:
(76085-032)
Supplier:
Bioss
Description:
In the presence of inorganic orthophosphate, the platelet-derived endothelial growth factor (PD-ECGF) thymidine phosphorylase (TP) (gliostatin) catalyses the reversible phospholytic cleavage of thymidine and deoxyuridine to their corresponding bases and 2-deoxyribose-1-phosphate. It is both chemotactic and mitogenic for endothelial cells and a non-heparin binding angiogenic factor present in platelets. It is also involved in transformation of fluoropyrimidines, cytotoxic agents used in the treatment of a variety of malignancies, into active cytotoxic metabolites.
Catalog Number:
(RL706-105-002)
Supplier:
Rockland Immunochemical
Description:
This product has been assayed against 1.0 µg of Guinea pig IgG in a standard capture ELISA using pNPP p-nitrophenyl phosphate as a substrate for 30 minutes at room temperature.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
![]()
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
![]()
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||