Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

You Searched For:

Methyl+4-(1-aminocyclopropyl)benzoate+hydrochloride


5,039  results were found

SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"5039"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  Anaspec Inc
Description:   This peptide is beta-amyloid (1-42) with substitution of Ser26 to Cys. This peptide has been used in a number of fluorescent tagged experiments and suited for fluorescent probe labeling.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGCNKGAIIGLMVGGVVIA
MW: 4530.2 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Supplier:  TCI America
Description:   [Substrate for beta-D-Glucosidase]
CAS Number: 2492-87-7
MDL Number: MFCD00006593
Molecular Formula: C12H15NO8
Molecular Weight: 301.25
Purity/Analysis Method: >98.0% (HPLC)
Form: Crystal
Melting point (°C): 167
Specific rotation [a]20/D: -102.5 deg (C=1, H2O)
Storage Temperature: 0-10°C
MSDS SDS
Supplier:  ANTIBODIES.COM LLC
Description:   Mouse monoclonal (ABT-TGFR2) antibody to TGF beta Receptor II for IHC with samples derived from Human.
Catalog Number: (103231-734)

Supplier:  Novus Biologicals
Description:   Thymosin beta 4, Polyclonal Antibody, Host: Sheep, Species reactivity: Human, Isotype: IgG, Immunogen: E. Coli-derived recombinant human Thymosin beta 4, Synonyms: FX, PTMB4, T beta-4, TB4X, TB4Xbeta 4, X chromosome, Application: WB, ICC, Size: 25ug
Supplier:  Prosci
Description:   The H57-597 monoclonal antibody is specific for the beta chain of the mouse T cell Receptor (TCR). The crosslinking induces activation and proliferation of T cells, as a plate-bound or a soluble H57-597, or the plate-bound antibody can induce apoptosis, based on assay conditions. The beta chain of the TCR can combine with the alpha chain of the receptor to produce the alpha-beta TCR, which is expressed by the NKT cells, by the NK1.1+ thymocytes and most of the T cells. The beta chain does not react with the gamma-delta TCR-bearing cells, expressed by a small number of T cells. This antibody can be used as a phenotypic marker for the TCR beta expressing cells or for the functional purpose of TCR-mediated cell activation or apoptosis.BG Violet 450 conjugate is an alternative to the Pacific Blue, eFluor 450, or BD Horizon V450 dyes. It is excited by the violet (405 nm) laser, with a peak emission of 450nm.
Supplier:  Biotium
Description:   Beta-catenin associates with the cytoplasmic portion of E-cadherin, which is necessary for the function of E-cadherin as an adhesion molecule. In normal tissues, beta-catenin is localized to the membrane of epithelial cells, consistent with its role in the cell adhesion complex. In breast ductal neoplasia, beta-catenin is usually localized in cellular membranes. However, in lobular neoplasia, a marked redistribution of beta-catenin throughout the cytoplasm results in a diffuse cytoplasmic pattern. Immuno-staining of beta-catenin and E-cadherin is helps in the accurate identification of ductal and lobular neoplasms, including a distinction between low-grade ductal carcinoma in situ (DCIS) and lobular carcinoma. Additionally, some rectal and gastric adenocarcinomas demonstrate diffuse cytoplasmic beta-catenin staining and a lack of membranous staining, mimicking the staining pattern observed with lobular breast carcinomas.

CF® dyes are Biotium's next-generation fluorescent dyes. CF®594 is a deep red fluorescent dye (Ex/Em 593/614 nm). It yields the brightest conjugates among spectrally similar dyes, and has excellent photostability.

Supplier:  Bioss
Description:   Transmembrane serine/threonine kinase forming with the TGF-beta type I serine/threonine kinase receptor, TGFBR1, the non-promiscuous receptor for the TGF-beta cytokines TGFB1, TGFB2 and TGFB3. Transduces the TGFB1, TGFB2 and TGFB3 signal from the cell surface to the cytoplasm and is thus regulating a plethora of physiological and pathological processes including cell cycle arrest in epithelial and hematopoietic cells, control of mesenchymal cell proliferation and differentiation, wound healing, extracellular matrix production, immunosuppression and carcinogenesis. The formation of the receptor complex composed of 2 TGFBR1 and 2 TGFBR2 molecules symmetrically bound to the cytokine dimer results in the phosphorylation and the activation of TGFRB1 by the constitutively active TGFBR2. Activated TGFBR1 phosphorylates SMAD2 which dissociates from the receptor and interacts with SMAD4. The SMAD2-SMAD4 complex is subsequently translocated to the nucleus where it modulates the transcription of the TGF-beta-regulated genes. This constitutes the canonical SMAD-dependent TGF-beta signaling cascade. Also involved in non-canonical, SMAD-independent TGF-beta signaling pathways.
Catalog Number: (89292-350)

Supplier:  Genetex
Description:   Rabbit Polyclonal antibody to Retinoid X Receptor beta
Catalog Number: (89367-652)

Supplier:  Genetex
Description:   Rabbit Polyclonal antibody to GSK3 beta (phospho Ser9)
Supplier:  ANTIBODIES.COM LLC
Description:   Rabbit polyclonal antibody to Nicotinic Acetylcholine Receptor beta 2 / CHRNB2 for WB with samples derived from Human, Mouse and Rat.

Supplier:  Bioss
Description:   2010013H22Rik; 2210021I22Rik; 2210401J11Rik; 3-galactosyl-O-glycosyl-glycoprotein beta-1; 6-N-acetylglucosaminyltransferase 3; 6-N-acetylglucosaminyltransferase; Beta 1 3 galactosyl O glycosyl glycoprotein beta 1 6 N acetylglucosaminyltransferase 3; Beta-1; Beta1 6 N acetylglucosaminyltransferase 3; beta1 6 N acetylglucosaminyltransferase; C2/4GnT; C24GNT; C2GnT M; C2GnT mucin type; C2GnT-M; C2GnT-mucin type; C2GnT2; C2GNTM; Core 2 beta 1 6 N acetylglucosaminyltransferase II; Core 2/core 4 beta 1 6 N acetylglucosaminyltransferase; Core 2/core 4 beta-1; dI/C2/C4GnT; EC 2.4.1.102; EC 2.4.1.150; GCNT3; GCNT3_HUMAN; Glucosaminyl (N acetyl) transferase 3; Glucosaminyl (N acetyl) transferase 3 mucin type; GnT M; GNTM; hC2GnT M; hC2GnT-M; Mucus-type core 2 beta-1,6-N-acetylglucosaminyltransferase. OTTHUMP00000163601.
Supplier:  Novus Biologicals
Description:   The beta-Actin Antibody [HRP] from Novus Biologicals is a rabbit polyclonal antibody to beta-Actin. This antibody reacts with human, mouse. The beta-Actin Antibody [HRP] has been validated for the following applications: Western Blot, Immunoprecipitation.

Supplier:  Genetex
Description:   Mouse monoclonal antibody [57/3] to Estrogen Receptor beta 2

Supplier:  Novus Biologicals
Description:   The Rev-erb beta / NR1D2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Rev-erb beta / NR1D2. This antibody reacts with human, mouse, rat, bat, bovine, canine, chicken, equine, monkey, primate, rabbit. The Rev-erb beta / NR1D2 Antibody has been validated for the following applications: ELISA, Immunohistochemistry-Paraffin.

Supplier:  Bioss
Description:   Integrin alpha-V/beta-3 is a receptor for cytotactin, fibronectin, laminin, matrix metalloproteinase-2, osteopontin, osteomodulin, prothrombin, thrombospondin, vitronectin and von Willebrand factor. Integrin alpha-IIb/beta-3 is a receptor for fibronectin, fibrinogen, plasminogen, prothrombin, thrombospondin and vitronectin. Integrins alpha-IIb/beta-3 and alpha-V/beta-3 recognize the sequence R-G-D in a wide array of ligands. Integrin alpha-IIb/beta-3 recognizes the sequence H-H-L-G-G-G-A-K-Q-A-G-D-V in fibrinogen gamma chain. Following activation integrin alpha-IIb/beta-3 brings about platelet/platelet interaction through binding of soluble fibrinogen. This step leads to rapid platelet aggregation which physically plugs ruptured endothelial surface. Fibrinogen binding enhances SELP expression in activated platelets (By similarity). In case of HIV-1 infection, the interaction with extracellular viral Tat protein seems to enhance angiogenesis in Kaposi's sarcoma lesions.

Supplier:  Novus Biologicals
Description:   The beta II Tubulin A Antibody from Novus Biologicals is a rabbit polyclonal antibody to beta II Tubulin A. This antibody reacts with human, mouse, rat, drosophila. The beta II Tubulin A Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry / Immunofluorescence, Immunohistochemistry-Paraffin.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
449 - 464  of 5,039
Prev