Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

1-(Bromomethyl)-4-fluoronaphthalene


26,649  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"26649"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Catalog Number: (77526-100)

Supplier:  AFG BIOSCIENCE LLC
Description:   Pig ITGb1 (Integrin Beta 1) ELISA Kit
Catalog Number: (103007-214)

Supplier:  Anaspec Inc
Description:   This is amino acids 1 to 40 fragment of the beta-amyloid peptide with lysine substituted for glutamic acid at position 22, found in Italian families. The Italian mutation of beta-amyloid 1-40 (E22K) aggregates more rapidly and with more potent neurotoxicity than wild-type beta-amyloid 1-40. The formation of a salt bridge between Lys-22 and Asp-23 in the minor conformer might be a reason why E22K-beta-amyloid 40 is more pathogenic than wild-type beta-amyloid 40.
Sequence: DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVV
Molecular Weight: 4328.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Supplier:  Novus Biologicals
Description:   The beta-Synuclein Antibody (4F11) from Novus Biologicals is a mouse monoclonal antibody to beta-Synuclein. This antibody reacts with human. The beta-Synuclein Antibody (4F11) has been validated for the following applications: Western Blot, ELISA.
Supplier:  Novus Biologicals
Description:   The AMPK beta 2 / PRKAB2 Antibody (2G9) from Novus Biologicals is a mouse monoclonal antibody to AMPK beta 2 / PRKAB2. This antibody reacts with human. The AMPK beta 2 / PRKAB2 Antibody (2G9) has been validated for the following applications: Western Blot, ELISA.
Catalog Number: (10075-972)

Supplier:  Prosci
Description:   Integrins are a major class of cell adhesion molecules that mediate cell matrix interactions. They are composed of an alpha and a beta subunit. Beta 1 heterodimers are widely expressed and control various developmental processes, including neurogenesis, chondrogenesis, myoblast fusion, and skin and hair follicle morphogenesis.

Supplier:  Genetex
Description:   Mouse monoclonal antibody [8H10D10] to beta Actin

Supplier:  Audit Microcontrols
Description:   Beta-Hydroxybutyric acid Linearity is assayed quality control material consisting of five levels of human based serum.
MSDS SDS
Supplier:  Novus Biologicals
Description:   The Mitochondrial-processing peptidase subunit beta Antibody (3C3) from Novus Biologicals is a mouse monoclonal antibody to Mitochondrial-processing peptidase subunit beta. This antibody reacts with human. The Mitochondrial-processing peptidase subunit beta Antibody (3C3) has been validated for the following applications: ELISA.
Supplier:  Bioss
Description:   Involved in embryogenesis and cell differentiation.
Catalog Number: (103228-664)

Supplier:  Novus Biologicals
Description:   17 beta-HSD1/HSD17B1 Antibody, Polyclonal, Host: Sheep, Species: Human, Isotype: IgG, Immunogen: E. Coli-derived recombinant human 17 beta -HSD1/HSD17B1 Ala2-Gln328, Synonyms: 17-beta-HSD 1, 20 alpha-hydroxysteroid dehydrogenase, Apps: WB, Size: 25UG
Supplier:  Novus Biologicals
Description:   The beta-III Tubulin Antibody (TU-20) [DyLight 488] from Novus Biologicals is a mouse monoclonal antibody to beta-III Tubulin. This antibody reacts with human, mouse, all species. The beta-III Tubulin Antibody (TU-20) [DyLight 488] has been validated for the following applications: Western Blot, Flow Cytometry, Immunohistochemistry, Immunocytochemistry / Immunofluorescence, Immunohistochemistry-Paraffin.
Supplier:  Novus Biologicals
Description:   The Hydrogen Potassium ATPase Beta Antibody (1D10) from Novus Biologicals is a mouse monoclonal antibody to Hydrogen Potassium ATPase Beta. This antibody reacts with human. The Hydrogen Potassium ATPase Beta Antibody (1D10) has been validated for the following applications: Western Blot, ELISA.
Supplier:  R&D Systems
Description:   The Recombinant Human Lymphotoxin-alpha/TNF-beta Protein from R&D Systems is derived from E. coli. The Recombinant Human Lymphotoxin-alpha/TNF-beta Protein has been validated for the following applications: Bioactivity.
Supplier:  Rockland Immunochemical
Description:   Recombinant Human Gro-Beta /CXCL2 control protein
Catalog Number: (103277-228)

Supplier:  Novus Biologicals
Description:   The GMF-beta Antibody from Novus Biologicals is a rabbit polyclonal antibody to GMF-beta. This antibody reacts with human, mouse, rat. The GMF-beta Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry / Immunofluorescence, Immunohistochemistry-Paraffin.

Supplier:  Novus Biologicals
Description:   The TR beta 1 / NR1A2 / Thyroid Hormone Receptor beta Antibody (2386) from Novus Biologicals is a mouse monoclonal antibody to TR beta 1 / NR1A2 / Thyroid Hormone Receptor beta. This antibody reacts with human. The TR beta 1 / NR1A2 / Thyroid Hormone Receptor beta Antibody (2386) has been validated for the following applications: Western Blot.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
4,225 - 4,240  of 26,649
Prev