2-Bromo-6-(methoxycarbonyl)benzoic+acid
Catalog Number:
(76960-276)
Supplier:
ANTIBODIES.COM LLC
Description:
Recombinant rabbit monoclonal [FSHb/2033R] antibody to FSH beta for Flow Cytometry, IF, WB and IHC-P with samples derived from Human.
Catalog Number:
(75790-236)
Supplier:
Prosci
Description:
Pregnancy-specific beta-1-glycoprotein 9(PSG9) is a secreted protein and contains 3 Ig-like C2-type (immunoglobulin-like) domains, 1 Ig-like V-type (immunoglobulin-like) domain. It is a member of the PSG family, a group of closely related secreted glycoproteins that are highly expressed in fetal placental syncytiotrophoblast cells. The members of the PSG protein family all have a characteristic N-terminal domain that is homologous to the immunoglobulin variable region. PSGs become detectable in serum during the first two to three weeks of pregnancy and increase as the pregnancy progresses, eventually representing the most abundant fetal protein in the maternal blood at term. PSGs function to stimulate secretion of TH2-type cytokines from monocytes, and they may also modulate the maternal immune system during pregnancy, thereby protecting the semi-allotypic fetus from rejection. PSGs are commonly expressed in trophoblast tumors. Eleven human PSG proteins (PSG1-PSG11) have been described.
Catalog Number:
(103003-038)
Supplier:
Anaspec Inc
Description:
Purified metalloendopeptidase cleaves the Gly33-Leu34 bond of Alzheimer Aß (1-40) peptide producing soluble 1-33 and 34-40 fragments of Aß (1-40) without any neurotoxic effects.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIG Molecular Weight: 3674 Da % Peak Area by HPLC: ≥95 Peptide Content: ≥ 60% Storage condition: -20°C
Catalog Number:
(10751-090)
Supplier:
Prosci
Description:
KPNA2 Antibody: Karyopherin, a cytosolic and heterodimeric protein complex consisting of alpha and beta subunits, is responsible for targeting proteins with nuclear localization signals to the nuclear pore complex by an energy requiring, Ran-dependent mechanism. The alpha subunit and imported substrate enter the nucleus and accumulate in the nucleoplasm, while the beta subunit accumulates at the NPC. KPNA2 is the alpha subunit 2 of karyopherin, which forms a complex with importin subunit beta-1 and functions as a cargo carrier that transports various complexes from cytoplasm into nucleus. It is ubiquitously expressed and contains an IBB/importin beta domain, ten Armadillo repeats that bind "cargo" and three intervening nuclear localization sequences (NLSs). It has recently been reported to play an important role in tumorigenesis and tumor progression.
Catalog Number:
(76234-990)
Supplier:
Rockland Immunochemical
Description:
HbC antibodies detect the E6K mutant in the hemoglobin beta subunit. Functional hemoglobin (Hb) is a hetero tetramer composed of 2 alpha and 2 beta subunits (α2β2). Common isoform variants of hemoglobin include HbA, HbS, HbC, HbF, and HbA2. Sickle cell disease (SCD), thalassemias and hemoglobinopathies occur when aberrant forms of hemoglobin are expressed in children and adults. Globin gene mutations affect the structure and expression levels of Hb. Sickle cell disease and the more benign sickle cell trait are observed in more than 100 million people globally. Less significant than the SCD-E6V, HbC E6K mutation causes a mild hemolytic anemia. HbC antibody does not react to other forms of Hb. This antibody is ideal for investigators involved in Cardiovascular and developmental biology research.
Catalog Number:
(89355-704)
Supplier:
Genetex
Description:
Rabbit Polyclonal antibody to Cav beta 1
Catalog Number:
(89319-994)
Supplier:
Genetex
Description:
Rabbit polyclonal antibody to GRK2 (adrenergic, beta, receptor kinase 1)
Catalog Number:
(77056-830)
Supplier:
ANTIBODIES.COM LLC
Description:
Rabbit polyclonal antibody to IL-8R beta for IF and ELISA with samples derived from Human and Mouse.
Catalog Number:
(76101-598)
Supplier:
Bioss
Description:
The protein encoded by this gene is a serine-threonine kinase, belonging to the glycogen synthase kinase subfamily. It is involved in energy metabolism, neuronal cell development, and body pattern formation. Polymorphisms in this gene have been implicated in modifying risk of Parkinson disease, and studies in mice show that overexpression of this gene may be relevant to the pathogenesis of Alzheimer disease. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Catalog Number:
(76701-224)
Supplier:
AFG BIOSCIENCE LLC
Description:
Human Transforming Growth Factor beta Receptor Type 3 (TGFBR3) ELISA Kit
Catalog Number:
(10324-692)
Supplier:
Bioss
Description:
JNK1 isoforms display different binding patterns: beta-1 preferentially binds to c-Jun, whereas alpha-1, alpha-2, and beta-2 have a similar low level of binding to both c-Jun or ATF2. However, there is no correlation between binding and phosphorylation, which is achieved at about the same efficiency by all isoforms.
Catalog Number:
(10236-184)
Supplier:
Bioss
Description:
Facilitative glucose transporter. This isoform likely mediates the bidirectional transfer of glucose across the plasma membrane of hepatocytes and is responsible for uptake of glucose by the beta cells; may comprise part of the glucose-sensing mechanism of the beta cell. May also participate with the Na(+)/glucose cotransporter in the transcellular transport of glucose in the small intestine and kidney.
Catalog Number:
(77437-684)
Supplier:
Bioss
Description:
Involved in interleukin-6 signal transduction, including the transcriptional activation of acute-phase genes. Functions in brown adipose tissue (BAT) differentiation.
Catalog Number:
(10338-604)
Supplier:
Bioss
Description:
SMAD2 or Mothers against decapentaplegic homolog 2 is a polypeptide that, as its name describes, is a homolog of the Drosophila gene: "Mothers against decepentaplegic". It belongs to the SMAD family of proteins, which belong to the TGF-Beta superfamily of modulators. Like many other TGF-Beta family members SMAD2 is involved in cell signalling. SMAD2 modulates signals of activin and TGF-Beta's. It interacts with SMAD anchor for receptor activation (SARA). The binding of ligands causes the phosphorylation of the SMAD2 protein and the dissociation from SARA and the association with SMAD4. It is subsequently transferred to the nucleus where it forms complexes with other proteins and acts as a transcription factor. SMAD2 is a receptor regulated SMAD (R-SMAD) and is activated by bone morphogenetic protein type 1 receptor kinase. Smad2 (Mothers against decapentaplegic homolog 2; SMAD 2; Mothers against DPP homolog 2;)
Catalog Number:
(10236-178)
Supplier:
Bioss
Description:
Facilitative glucose transporter. This isoform likely mediates the bidirectional transfer of glucose across the plasma membrane of hepatocytes and is responsible for uptake of glucose by the beta cells; may comprise part of the glucose-sensing mechanism of the beta cell. May also participate with the Na(+)/glucose cotransporter in the transcellular transport of glucose in the small intestine and kidney.
Catalog Number:
(76194-036)
Supplier:
Prosci
Description:
Importins transport molecules into the nucleus via nuclear localization sequences binding. There are over 20 human importins identified, divided in the alpha and beta subfamilies. Importin-9 is a beta importin, responsible for the import of the core histones H2A, H2B, H3 and H4 into the nucleus.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
![]()
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
![]()
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||