Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

N-(Cyclopentylcarbonyl)-beta-alanine


30,530  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"30530"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  R&D Systems
Description:   The Recombinant Human beta-Galactosidase-1/GLB1 Protein from R&D Systems is derived from CHO. The Recombinant Human beta-Galactosidase-1/GLB1 Protein has been validated for the following applications: Enzyme Activity.

Supplier:  AFG BIOSCIENCE LLC
Description:   Mouse CRYbB2 (Crystallin Beta B2) ELISA Kit
Supplier:  Novus Biologicals
Description:   The beta 2-Microglobulin Antibody (B2M / 961) [Allophycocyanin] from Novus Biologicals is a mouse monoclonal antibody to beta 2-Microglobulin. This antibody reacts with human, primate. The beta 2-Microglobulin Antibody (B2M / 961) [Allophycocyanin] has been validated for the following applications: Flow Cytometry, Flow (Cell Surface).
Supplier:  Anaspec Inc
Description:   Beta-amyloid is the main component of amyloid deposits in the AD brain. Beta-amyloid peptides have a heterogeneous C-terminus with the majority composed ofAβ1-40, while a minor product is Aβ 1-42. Additional minor Aβ peptides are also normally produced, such as Beta-amyloid 1-34, 1-37, 1-38 and 1-39, and few reports have quantified the levels of these peptides in the brain.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGG
Molecular Weight: 4131.6 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Supplier:  TCI America
Description:   [Ultra-high sensitive spectrophotometric reagent for Cu, Mg][For the simultaneous determination of metals by HPLC]
CAS Number: 36951-72-1
MDL Number: MFCD00013468
Molecular Formula: C72H66N8O12S4
Molecular Weight: 1363.60
Purity/Analysis Method: >98.0% (N)
Form: Crystal
MSDS SDS
Supplier:  THERMO FISHER SCIENTIFIC CHEMICALS
Description:   β-Methasone valerate
Supplier:  Biotium
Description:   HCG-beta, Monoclonal antibody, Clone: HCGb/54+ HCGb/459, Host: Mouse, Species reactivity: Human, Isotype: IgG's, BSA-free, Immunogen: Recombinant hCG beta protein (HCGb/54 and HCGb/459), Synonyms: CG-beta; CGB3; CGB5; CGB7; CGB8, Application: Immunohistochemistry, Size: 50 uL
Supplier:  Novus Biologicals
Description:   The PI 3-Kinase p110 beta / PIK3CB Antibody (10D5) from Novus Biologicals is a mouse monoclonal antibody to PI 3-Kinase p110 beta / PIK3CB. This antibody reacts with human. The PI 3-Kinase p110 beta / PIK3CB Antibody (10D5) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry / Immunofluorescence, Proximity Ligation Assay.
Catalog Number: (103229-734)

Supplier:  Novus Biologicals
Description:   Beta-1,3-N-Acetylglucosaminyltransferase 1/B3GNT1 Polyclonal Antibody, Host: sheep, Species reactivity: Human, Mouse, Isotype: IgG, synonyms: i-beta-1,3-N-acetylglucosaminyltransferase, Application: WB, Size: 100UG
Supplier:  Novus Biologicals
Description:   The PKA regulatory subunit I beta Antibody from Novus Biologicals is a mouse polyclonal antibody to PKA regulatory subunit I beta. This antibody reacts with human. The PKA regulatory subunit I beta Antibody has been validated for the following applications: Western Blot, Immunocytochemistry / Immunofluorescence.
Supplier:  Novus Biologicals
Description:   The ATPase Na+ / K+ beta 3 Antibody (2F4) from Novus Biologicals is a mouse monoclonal antibody to ATPase Na+ / K+ beta 3. This antibody reacts with human. The ATPase Na+ / K+ beta 3 Antibody (2F4) has been validated for the following applications: Western Blot, ELISA.
Supplier:  Novus Biologicals
Description:   The ARNT / HIF-1 beta Antibody (H1beta234) [DyLight 680] from Novus Biologicals is a mouse monoclonal antibody to ARNT / HIF-1 beta. This antibody reacts with human, mouse, rat, bovine, ferret, primate, sheep. The ARNT / HIF-1 beta Antibody (H1beta234) [DyLight 680] has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry / Immunofluorescence, Immunohistochemistry-Paraffin.
Catalog Number: (76734-148)

Supplier:  ANTIBODIES.COM LLC
Description:   Human CCL4/MIP-1 beta ELISA kit is a sandwich Enzyme-Linked Immunosorbent Assay (sELISA) designed for the <i>in vitro</i> quantitative determination of human CCL4/MIP-1 beta in serum, plasma, tissue homogenates, and other biological fluids.

Supplier:  AFG BIOSCIENCE LLC
Description:   Human PCDHb15 (Protocadherin Beta 15) ELISA Kit
Supplier:  Bioss
Description:   IKK Alpha/IKK beta is a member of the IKK complex which is composed of IKK alpha, IKK beta, IKK gamma and IKAP. Phosphorylation of I-Kappa-B on a serine residue by the IKK complex frees NF-kB from I-Kappa-B and marks it for degradation via ubiquination. IKK beta has been shown to activate NF-kB and phosphorylate IKB alpha and beta. Phosphorylation of 2 sites at the activation loop of IKK beta is essential for activation of IKK by TNF and IL1. Once activated, IKK beta autophosphorylates which in turn decreases IKK activity and prevents prolonged activation of the inflammatory response. Additionally, IKK beta activity can also be regulated by MEKK1.
Supplier:  Thermo Fisher Scientific
Description:   Protect lab workers during procedures that require handling of beta emitting isotopes
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
2,193 - 2,208  of 30,530