Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

2-(Acetylamino)-3-[(4-chlorophenyl)sulfanyl]propanoic+acid


30,529  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"30529"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 


Supplier:  ANTIBODIES.COM LLC
Description:   Human beta 2 Adrenergic receptor ELISA kit is a 90 minute sandwich Enzyme-Linked Immunosorbent Assay (sELISA) designed for the <i>in vitro</i> quantitative determination of human beta 2 Adrenergic receptor in serum, plasma, and other biological fluids.
Supplier:  Novus Biologicals
Description:   The Integrin alpha V beta 3 Antibody (23C6) [DyLight 755] from Novus Biologicals is a mouse monoclonal antibody to Integrin alpha V beta 3. This antibody reacts with human. The Integrin alpha V beta 3 Antibody (23C6) [DyLight 755] has been validated for the following applications: Flow Cytometry, Immunohistochemistry, Immunohistochemistry-Frozen.

Supplier:  ANTIBODIES.COM LLC
Description:   Monkey beta Nerve Growth Factor ELISA kit is a sandwich Enzyme-Linked Immunosorbent Assay (sELISA) designed for the <i>in vitro</i> quantitative determination of monkey beta Nerve Growth Factor in serum, plasma, tissue homogenates, and other biological fluids.

Supplier:  ANTIBODIES.COM LLC
Description:   Bovine Phospholipase C beta 1/PLCB1 ELISA kit is a sandwich Enzyme-Linked Immunosorbent Assay (sELISA) designed for the <i>in vitro</i> quantitative determination of bovine Phospholipase C beta 1/PLCB1 in serum, plasma, tissue homogenates, and other biological fluids.

Supplier:  Novus Biologicals
Description:   The Common beta Chain Antibody from Novus Biologicals is a rabbit polyclonal antibody to Common beta Chain. This antibody reacts with human. The Common beta Chain Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Supplier:  Anaspec Inc
Description:   This peptide corresponds to the CtoN inverted sequence of Beta-amyloid 1-42.
Sequence: AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
Molecular Weight: 4514.1 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier:  ANTIBODIES.COM LLC
Description:   Mouse Retinoic acid Receptor beta ELISA kit is a 90 minutes sandwich Enzyme-Linked Immunosorbent Assay (sELISA) designed for the <i>in vitro</i> quantitative determination of mouse Retinoic acid Receptor beta in serum, plasma, and other biological fluids.
Catalog Number: (89362-812)

Supplier:  Genetex
Description:   Beta galactosidase antibodies can be used to detect beta-galactosidase expression by the lacZ gene and for screening of beta galactosidase antibodies.
Supplier:  AFG BIOSCIENCE LLC
Description:   Human bMSH (Beta-Melanocyte Stimulating Hormone) ELISA Kit
Supplier:  Bachem Americas
Description:   Sequence: H-Phe-Arg-βNA · 2 HCl
Catalog Number: (89361-750)

Supplier:  Genetex
Description:   Rabbit polyclonal to PKC beta 1 + PKC beta 2 ( phospho T500 )
Supplier:  ACROBIOSYSTEMS INC MS
Description:   Mouse Integrin alpha 1 beta 1 (ITGA1&ITGB1) Heterodimer Protein, His Tag&Tag Free, Source: expressed from HEK293, Predicted N-terminus: Phe 29 (ITGA1) & Gln 21 (ITGB1), Molecular weight: 130 kDa (ITGA1) and 83.5 kDa (ITGB1), Synonyms: Integrin alpha 1 beta 1, ITGA1&ITGB1, Size: 100uG

Supplier:  Novus Biologicals
Description:   The Tubulin Beta 4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Tubulin Beta 4. This antibody reacts with human, mouse. The Tubulin Beta 4 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry / Immunofluorescence.

Supplier:  Novus Biologicals
Description:   The PI4KB / PI4KIII beta Antibody from Novus Biologicals is a rabbit polyclonal antibody to PI4KB / PI4KIII beta. This antibody reacts with human. The PI4KB / PI4KIII beta Antibody has been validated for the following applications: Western Blot, Immunoprecipitation.
Supplier:  Novus Biologicals
Description:   The beta-Synuclein Antibody (3G6) from Novus Biologicals is a mouse monoclonal antibody to beta-Synuclein. This antibody reacts with human. The beta-Synuclein Antibody (3G6) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry / Immunofluorescence.
Supplier:  Novus Biologicals
Description:   The 17-Beta-Estradiol Antibody (4S24 (BGN / 06 / 8824)) [DyLight 405] from Novus Biologicals is a mouse monoclonal antibody to 17-Beta-Estradiol. This antibody reacts with all species. The 17-Beta-Estradiol Antibody (4S24 (BGN / 06 / 8824)) [DyLight 405] has been validated for the following applications: ELISA.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
4,497 - 4,512  of 30,529
Prev   4  5  6  7  8  9  10  11  12  13  14  15  16  17  18  19  Next