Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

N-(Cyclopentylcarbonyl)-beta-alanine


30,530  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"30530"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  Novus Biologicals
Description:   The 17-Beta-Estradiol Antibody (4S112 (BGN / 06 / 88112)) [DyLight 650] from Novus Biologicals is a mouse monoclonal antibody to 17-Beta-Estradiol. This antibody reacts with all species. The 17-Beta-Estradiol Antibody (4S112 (BGN / 06 / 88112)) [DyLight 650] has been validated for the following applications: ELISA.
Catalog Number: (103597-600)

Supplier:  Sino Biological
Description:   Produced in rabbits immunized with purified, recombinant Cynomolgus 14-3-3 beta / YWHAB ( Catalog#90022-CNCE; Q4R572-2; Met2-Asn244). 14-3-3 beta / YWHAB specific IgG was purified by Cynomolgus 14-3-3 beta / YWHAB affinity chromatography.
Supplier:  Bioss
Description:   Hexosaminidase B is the beta subunit of the lysosomal enzyme beta-hexosaminidase that, together with the cofactor GM2 activator protein, catalyzes the degradation of the ganglioside GM2, and other molecules containing terminal N-acetyl hexosamines. Beta-hexosaminidase is composed of two subunits, alpha and beta, which are encoded by separate genes. Both beta-hexosaminidase alpha and beta subunits are members of family 20 of glycosyl hydrolases. Mutations in the alpha or beta subunit genes lead to an accumulation of GM2 ganglioside in neurons and neurodegenerative disorders termed the GM2 gangliosidoses. Beta subunit gene mutations lead to Sandhoff disease (GM2-gangliosidosis type II).
Supplier:  LGC STANDARDS
Description:   Nicotinamide Riboside-d4 Triflate (d3-Major) alpha/beta mixture, TRC, LGC Standards
New Product
Supplier:  Novus Biologicals
Description:   The IKK beta Antibody (10A9B6) [DyLight 350] from Novus Biologicals is a mouse monoclonal antibody to IKK beta. This antibody reacts with human, mouse. The IKK beta Antibody (10A9B6) [DyLight 350] has been validated for the following applications: Western Blot, Flow Cytometry, Immunocytochemistry / Immunofluorescence, Flow (Intracellular).
Supplier:  Novus Biologicals
Description:   The beta 2-Microglobulin Antibody (B2M / 1118) [DyLight 488] from Novus Biologicals is a mouse monoclonal antibody to beta 2-Microglobulin. This antibody reacts with human, primate. The beta 2-Microglobulin Antibody (B2M / 1118) [DyLight 488] has been validated for the following applications: Flow Cytometry, Immunohistochemistry-Paraffin.

Supplier:  Novus Biologicals
Description:   The IFN-alpha / beta R1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to IFN-alpha / beta R1. This antibody reacts with human. The IFN-alpha / beta R1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry / Immunofluorescence, Immunohistochemistry-Paraffin.
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 041641-250MG , MDL Number: MFCD02682505
Catalog Number: (89320-554)

Supplier:  Genetex
Description:   Rabbit Polyclonal antibody to beta Catenin (catenin (cadherin-associated protein), beta 1, 88kDa)
Supplier:  THERMO FISHER SCIENTIFIC CHEMICALS
Description:   2-Methylnaphthalene 96%
Catalog Number: (89318-808)

Supplier:  Genetex
Description:   Rabbit Polyclonal antibody to Integrin beta 5 (integrin, beta 5)

Supplier:  Bioss
Description:   Integrin alpha-L/beta-2 is a receptor for ICAM1, ICAM2, ICAM3 and ICAM4. Integrins alpha-M/beta-2 and alpha-X/beta-2 are receptors for the iC3b fragment of the third complement component and for fibrinogen. Integrin alpha-X/beta-2 recognizes the sequence G-P-R in fibrinogen alpha-chain. Integrin alpha-M/beta-2 recognizes P1 and P2 peptides of fibrinogen gamma chain. Integrin alpha-M/beta-2 is also a receptor for factor X. Integrin alpha-D/beta-2 is a receptor for ICAM3 and VCAM1. Triggers neutrophil transmigration during lung injury through PTK2B/PYK2-mediated activation.

Supplier:  Novus Biologicals
Description:   The beta Sarcoglycan Antibody from Novus Biologicals is a rabbit polyclonal antibody to beta Sarcoglycan. This antibody reacts with human, mouse. The beta Sarcoglycan Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Catalog Number: (103007-210)

Supplier:  Anaspec Inc
Description:   This peptide is naturally occurring mutant within the beta-amyloid region of b-amyloid protein precursor (APP). This mutation is associated with severe cerebral amyloid beta-protein angiopathy (CAA) in Iowa kindred. The affected individuals share a missense mutation in APP at position 694. This site corresponds to residue 23 of beta-amyloid peptide resulting in substitution of asparagine for aspartic acid.
Sequence: DAEFRHDSGYEVHHQKLVFFAENVGSNKGAIIGLMVGGVV
Molecular Weight: 4328.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier:  Novus Biologicals
Description:   The TFIIE beta Antibody from Novus Biologicals is a rabbit polyclonal antibody to TFIIE beta. This antibody reacts with human, mouse, rat. The TFIIE beta Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry / Immunofluorescence, Immunohistochemistry-Paraffin.
Catalog Number: (103223-104)

Supplier:  Novus Biologicals
Description:   Cysteine Conjugate beta-Lyase/CCBL1, Polyclonal Antibody, Host: Goat, Species reactivity: Human, Mouse, Rat, Isotype: IgG, synonyms: cysteine conjugate-beta lyase, cytoplasmic, Application: WB, storage: -20 to -70 deg C, Size: 25UG
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
2,785 - 2,800  of 30,530