Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

2-(Methoxymethyl)benzene-1,4-diamine


30,530  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"30530"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  ANTIBODIES.COM LLC
Description:   Recombinant mouse monoclonal [rHCGb/54] antibody to HCG beta for IHC-P with samples derived from Human.
Catalog Number: (102709-952)

Supplier:  Novus Biologicals
Description:   The Nicotinic Acetylcholine Receptor beta Antibody from Novus Biologicals is a rabbit polyclonal antibody to Nicotinic Acetylcholine Receptor beta. This antibody reacts with human. The Nicotinic Acetylcholine Receptor beta Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Catalog Number: (89328-646)

Supplier:  Genetex
Description:   Rabbit polyclonal antibody to PI3K beta, C-term
Supplier:  ANTIBODIES.COM LLC
Description:   Mouse monoclonal [6F9] antibody to beta Catenin for Flow Cytometry, IF, WB and IHC-P with samples derived from Human, Bovine, Canine and Chicken.

Supplier:  ANTIBODIES.COM LLC
Description:   Goat polyclonal antibody to LXR alpha + LXR beta for ELISA, WB, IF and Flow Cytometry with samples derived from Human.

Supplier:  ANTIBODIES.COM LLC
Description:   Rabbit polyclonal antibody to PDGFR beta for WB, IHC, IF and ELISA with samples derived from Human, Mouse and Rat.
Supplier:  ANTIBODIES.COM LLC
Description:   Rabbit polyclonal antibody to Luteinizing Hormone beta for WB with samples derived from Human.
Supplier:  ANTIBODIES.COM LLC
Description:   Mouse monoclonal (ABT-HCGβ) antibody to hCG beta for IHC with samples derived from Human.

Supplier:  ANTIBODIES.COM LLC
Description:   Rabbit polyclonal antibody to DNA Polymerase beta for WB, IP, IF and ELISA with samples derived from Human, Mouse, Rat and Hamster.
Catalog Number: (10458-886)

Supplier:  Bioss
Description:   Phospholipase C beta 1 catalyzes the formation of inositol 1,4,5-trisphosphate and diacylglycerol from phosphatidylinositol 4,5-bisphosphate. This reaction uses calcium as a cofactor and plays an important role in the intracellular transduction of many extracellular signals. Its gene is activated by two G-protein alpha subunits, alpha-q and alpha-11. Two transcript variants encoding different isoforms have been found for its gene.
Catalog Number: (102162-202)

Supplier:  Novus Biologicals
Description:   The Nicotinic Acetylcholine Receptor beta 2 Antibody from Novus Biologicals is a goat polyclonal antibody to Nicotinic Acetylcholine Receptor beta 2. This antibody reacts with human. The Nicotinic Acetylcholine Receptor beta 2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry-Paraffin, Peptide ELISA.
Catalog Number: (89292-410)

Supplier:  Genetex
Description:   Rabbit Polyclonal antibody to Progestin Receptor beta
Supplier:  Novus Biologicals
Description:   The beta-1,3-Glucuronyltransferase 1 / B3GAT1 Antibody [DyLight 488] from Novus Biologicals is a rabbit polyclonal antibody to beta-1,3-Glucuronyltransferase 1 / B3GAT1. This antibody reacts with human, mouse. The beta-1,3-Glucuronyltransferase 1 / B3GAT1 Antibody [DyLight 488] has been validated for the following applications: Immunohistochemistry, Immunocytochemistry / Immunofluorescence, Immunohistochemistry-Paraffin.
Catalog Number: (102997-266)

Supplier:  Anaspec Inc
Description:   This peptide is beta-amyloid (1-40) N-terminally truncated. It was shown that supplementing the media with N-terminally truncated Abeta (2-40) and (2-42) induce the phagocytosis of polystyrene particles by primary human monocytes. N-terminally truncated Aβ(x–42) induced the phagocytosis of PSPs significantly more effectively than did Aβ(x–40).
Sequence: AEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight: 4214.8 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Catalog Number: (89319-992)

Supplier:  Genetex
Description:   Rabbit polyclonal antibody to PI4K2B (phosphatidylinositol 4-kinase type 2 beta)
Catalog Number: (89361-736)

Supplier:  Genetex
Description:   Rabbit polyclonal to PKC beta 2 ( phospho T641 )
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
-95 - -80  of 30,530