Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

Nickel(II)+p-toluenesulfonate


18,821  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"18821"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Catalog Number: (101418-894)

Supplier:  Strem Chemicals Inc
Description:   BINAP
Supplier:  Bachem Americas
Description:   5mg CAS: 380900-00-5 C34H47N7O8 FW: 681.79 . Synonym: (Ala1)-Proteinase Activated Receptor 4 (1-6) (mouse), (Ala1)-Thrombin Receptor-Like 3 (1-6) (mouse), (Ala1)-Coagulation Factor II Receptor-Like 3 (1-6) (mouse), AYPGKF
Catalog Number: (470123-440)

Supplier:  Wards
Description:   Count up to 29:59 with resolution of ¹/â‚… sec. It is nickel-plated and features two-dials and a hard carrying case.

Supplier:  Bioss
Description:   KRT82 is a member of the keratin gene family. As a type II hair keratin, it is a basic protein which heterodimerizes with type I keratins to form hair and nails. The type II hair keratins are clustered in a region of chromosome 12q13 and are grouped into two distinct subfamilies based on structure similarity. One subfamily, consisting of KRTHB1, KRTHB3, and KRTHB6, is highly related. The other less-related subfamily includes KRTHB2, KRTHB4, and KRTHB5. All hair keratins are expressed in the hair follicle; this keratin appears to be a hair cuticle-specific keratin.
Catalog Number: (103007-474)

Supplier:  Anaspec Inc
Description:   This peptide is amino acids 154 to 186 fragment of secretogranin II, designated secretoneurin. Secretoneurin is a neuropeptide generated in brain, adrenal medulla and other endocrine tissues by proteolytic processing of secretogranin II. Secretoneurin acts as direct angiogenic cytokine, inhibits endothelial cell (EC) apoptosis, stimulates EC proliferation, and activates the mitogen-activated protein kinase (MAPK) system and the Akt pathway.
Sequence:TNEIVEEQYTPQSLATLESVFQELGKLTGPSNQ
MW:3652 Da
% peak area by HPLC:95
Storage condition:-20° C
Supplier:  Hamilton
Description:   Metal hub (nickel plated brass) needles can be used with TLL syringes and LT or TLL connectors.
Supplier:  Supra Sciences
Description:   Strongly acidic supported reagent capable of scavenging most amines from reaction media as well as some analines.
MSDS SDS
Supplier:  Brady Worldwide
Description:   Cryogenic labels for tubes, vials and canes.
Supplier:  Bon Opus Biosciences
Description:   Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products
Catalog Number: (76474-858)

Supplier:  PERKINELMER U.S. LLC
Description:   The Intracooler Series cool the sample holder enclosure block of the DSC instruments.
Supplier:  Bioss
Description:   Preferentially catalyzes the dephosphorylation of 'Ser-5' within the tandem 7 residues repeats in the C-terminal domain (CTD) of the largest RNA polymerase II subunit POLR2A. Negatively regulates RNA polymerase II transcription, possibly by controlling the transition from initiation/capping to processive transcript elongation (By similarity). Recruited by REST to neuronal genes that contain RE-1 elements, leading to neuronal gene silencing in non-neuronal cells.
Supplier:  VWR International
Description:   Designed with a flame stabilizer to provide a steady flame for general laboratory needs.
Supplier:  Thermo Scientific Chemicals
Description:   indicating (CaSO„), Lab Grade.Granular, -4+6 Mesh,WARNING: Irritates skin and eyes,1lb,5lb.
MSDS SDS
Supplier:  Thermo Scientific Chemicals
Description:   In hardening steel, preservatives, manufacturing of cements, porcelain, enamels, glass, borates, artificial gems, in nickeling baths, painting, photography
MSDS SDS

Supplier:  Prosci
Description:   TGF-beta receptor type-2 (TGFBR2 or TGFR-2) is also known as TGF-beta type II receptor, Transforming growth factor-beta receptor type II, TbetaR-II, TGF?R2, which is a homodimer or heterohexamer, belongs to the protein kinase superfamily, TKL Ser/Thr protein kinase family and TGFB receptor subfamily. TGFR2 / TGFBR2 binds TGF-?1 / TGFB1 and TGF-?3 / TGFB3 with high affinity and TGF-?2 / TGFB2 with a much lower affinity. This type I I receptor forms a heterodimeric complex with type I receptor and is essential for signal transduction. Upon ligand binding, the TGFR2 autophosphorylates its cytoplasmic domain and subsequently phosphorylates the downstream molecules which then enter the nucleus and regulate the transcription of a subset of genes related to cell proliferation.
Supplier:  ANTIBODIES.COM LLC
Description:   Mouse monoclonal (ABT-CD74) antibody to CD74 for IHC with samples derived from Human.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
5,489 - 5,504  of 18,821