Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

Okadaic+acid+ammonium+salt


135,999  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"135999"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  Thermo Scientific Chemicals
Description:   A gelling polysaccharide extracted from giant brown seaweed, useful in viscosity studies
MSDS SDS
Catalog Number: (82024-256)

Supplier:  GE Healthcare - HyClone
Description:   Trypan Blue solution, 0,4%, is routinely used as a cell stain to assess cell viability using the dye exclusion test.
Catalog Number: (103008-246)

Supplier:  Anaspec Inc
Description:   Pramlintide is the first in the new class of amylinomimetic compounds and is a synthetic analogue of the human hormone Amylin, a 37 amino acid peptide. Pramlintide’s peptide sequence differs from Amylin by replacing proline at postitions 25, 28, and 29. Pramlintide has a disulfide bridge between C2 and C7. For Research Use Only.
Sequence: KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2 (S-S Bond) acetate salt
MW: 3949.5 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C
Supplier:  Honeywell Research Chemicals
Description:   Sodium silicate solution, Grade: Reagent, Cas number: 6834-92-0, Molecular Formula: Na2O(SiO2)xA. XH2O, Synonyms: Sodium trisilicate solution, Water glass, Laboratory Chemical, General Purpose Reagent, approx 10.6%, SiO2, approx 26.5%, Size: 3L
MSDS SDS
Supplier:  MilliporeSigma
MSDS SDS
Supplier:  TCI America
Description:   CAS Number: 5793-98-6
MDL Number: MFCD00043437
Molecular Formula: C2H4O2S
Molecular Weight: 130.17
Purity/Analysis Method: >94.0% (T)
Form: Crystal
Color: White
MSDS SDS

Supplier:  Thermo Scientific Chemicals
Description:   99.99%. 1g.
MSDS SDS
Supplier:  TCI America
Description:   CAS Number: 140-89-6
MDL Number: MFCD00004931
Molecular Formula: C3H6OS2
Molecular Weight: 160.29
Purity/Analysis Method: >95.0% (T)
Form: Crystal
Melting point (°C): 210
Flash Point (°C): 96
MSDS SDS
Supplier:  RPI
Description:   RPI Magnesium Acetate Tetrahydrate, CAS Number: 16674-78-5, Molecular Weight: 214.45, Chemical Formula: (CH3COO)2Mg. 4H2O, Solubility: Water, Storage Temperature: Room Temperature, Appearance: White Crystals, Size: 5kg
Supplier:  Spectrum Chemicals
Description:   Sodium Acetate, Trihydrate, Granular, USP is a moderately water soluble crystalline source of Sodium and serves as processing aid excipient. 
Small Business Enterprise
Supplier:  TCI America
Description:   CAS Number: 532-94-5
MDL Number: MFCD00002693
Molecular Formula: C9H9NO3
Molecular Weight: 201.16
Purity/Analysis Method: >98.0% (T)
Form: Crystal
MSDS SDS
Supplier:  MilliporeSigma
Description:   Desiccant suitable for desiccators to remove water, and for drying most gases and liquids (apart from strongly acidic and basic gases, organic solvents or alkaline liquids). The product contains iron salts as the indicator. The colour change is from orange to colourless at approx 7/10 g adsorbed H2O/100 g silica gel. Regeneration can be performed as often as required at 130 - 140 °C in a drying oven for three hours.
Supplier:  Spectrum Chemicals
Description:   Sodium Acetate, Anhydrous, FCC is used for controlling the pH level of food items and acts as a preservative. The FCC grade meets the requirements of the Food Chemical Codex indicates and is suitable for all food, beverage and nutritional supplement applications. Spectrum Chemical offers over 300 Food grade chemical ingredients packaged in laboratory size bottles to production drum quantities and are manufactured, packaged and stored under current Good Manufacturing Practices (cGMP) per 21CFR part 211 in FDA registered and inspected facilities.
Supplier:  AOB CHEM USA
Description:   Potassium(3-chloro-4-fluorophenyl)trifluoroborate ≥95%
Supplier:  MilliporeSigma
Supplier:  TCI America
Description:   CAS Number: 137076-54-1
MDL Number: MFCD02259697
Molecular Formula: C28H52N4O8
Molecular Weight: 572.74
Purity/Analysis Method: >97.0% (T)
Form: Crystal
Color: White
Storage Temperature: 0-10°C
MSDS SDS
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
3,745 - 3,760  of 135,999