Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results


SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"14886"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Catalog Number: (TCM0012-25ML)

Supplier:  TCI America
Description:   CAS Number: 624-48-6
MDL Number: MFCD00008459
Molecular Formula: C6H8O4
Molecular Weight: 144.13
Purity/Analysis Method: >95.0% (GC)
Form: Clear Liquid
Boiling point (°C): 205
Melting point (°C): -19
Flash Point (°C): 103
Specific Gravity (20/20): 1.15
MSDS SDS
Catalog Number: (76750-256)

Supplier:  Prosci
Description:   Anti-PRPF8 Rabbit Polyclonal Antibody
Supplier:  Corning
Description:   Boiling flasks have short necks and carefully controlled wall thicknesses to maintain proper balance between thermal expansion and mechanical strength for optimal shock resistance. These flasks are equipped with standard taper 14/20 outer joint, standard taper 19/22 joint, and standard taper 24/40 joint.
Environmentally Preferable
Catalog Number: (10105-424)

Supplier:  Prosci
Description:   The ZNF537 gene is located on chromosome 19.
Catalog Number: (76751-388)

Supplier:  Prosci
Description:   Anti-FUS Rabbit Polyclonal Antibody
Supplier:  ACCUFORM MANUFACTURING, INC
Description:   Floor Signs alert and remind those to practice social and physical distancing to prevent the spread of COVID-19, the Coronavirus.
Catalog Number: (103003-158)

Supplier:  Anaspec Inc
Description:   Rat adrenomedullin, rADM, (1-50) and its C-terminal rADM (11-50) induce a dose-dependent and endothelium-independent vasodilation on the arterial mesenteric vasculature.
Sequence:YRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY-NH2 (Disulfide bridge: 14-19)
MW:5729.5 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Catalog Number: (76480-598)

Supplier:  AAT BIOQUEST INC
Description:   Maleimides are among the most frequently used reagents for thiol modification.
Small Business Enterprise Minority or Woman-Owned Business Enterprise
Supplier:  BeanTown Chemical
Description:   CAS: 61-19-8; EC No: 200-500-0; MDL No: MFCD00149360; RTECS: AU7480500 Crystalline/Powder; Molecular Formula: C10H14N5O7P·H2O; MW: 365.24
MSDS SDS

Supplier:  AOB CHEM USA
Description:   Methyl-5-bromothiophene-2-carboxylate ≥97%
Supplier:  Biotium
Description:   CD56 / NCAM Monoclonal antibody, Clone: 123C3.D5, Host: Mouse, Species reactivity: Human, Isotype: IgG1, kappa, Conjugate: CF640R, Immunogen: Membrane preparation of a small cell lung carcinoma, Synonyms: NCAM, Leu-19, NKH1, Size: 500 uL

Supplier:  ACCUFORM MANUFACTURING, INC
Description:   Floor Signs alert and remind those to practice social and physical distancing to prevent the spread of COVID-19, the Coronavirus.
Supplier:  THERMO FISHER SCIENTIFIC CHEMICALS
Description:   Acetic acid 99.5%, pure
New Product

Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 038637-500MG , MDL Number: MFCD02661897

Supplier:  Matrix Scientific
Description:   MF=C17H18N2Os MW=298.41 MDL=MFCD05369374 500Mg
Supplier:  Sklar
Description:   Bishop-Harmon Anterior Chamber Irrigating Cannulas are stainless steel
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
817 - 832  of 14,886
Prev